Project name: 5675563cfcd9089

Status: done

Started: 2026-05-20 05:20:10
Settings
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGSGAANNPMGWFRQAPGKGRELVAAIGGAGSTSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAARGSSSVSSGGGVNKEYATDPSYYSFWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:40)
Show buried residues

Minimal score value
-2.9044
Maximal score value
1.0578
Average score
-0.7609
Total score value
-102.72

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.0788
2 V A -1.2811
3 Q A -1.0980
4 L A 0.0000
5 V A 1.0578
6 E A 0.0000
7 S A -0.4436
8 G A -1.0861
9 G A -0.7557
10 G A -0.0574
11 L A 0.9145
12 V A 0.0000
13 Q A -1.4977
14 P A -1.7553
15 G A -1.5041
16 G A -1.0128
17 S A -1.0151
18 L A -0.7585
19 R A -1.8317
20 L A 0.0000
21 S A -0.3027
22 C A 0.0000
23 A A -0.1814
24 A A 0.0000
25 S A -1.0423
26 G A -1.3735
27 S A -0.8432
28 G A -1.1190
29 A A 0.0000
30 A A -1.5671
31 N A -1.6072
32 N A 0.0000
33 P A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.7234
40 A A -1.6080
41 P A -1.1721
42 G A -1.6580
43 K A -2.7265
44 G A -2.3139
45 R A -2.3742
46 E A -2.4840
47 L A 0.0000
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 G A 0.0000
53 G A 0.0000
54 A A -1.0156
55 G A -0.8785
56 S A -0.5899
57 T A -0.3067
58 S A -0.3900
59 T A -0.3729
60 Y A -0.9138
61 Y A -1.3326
62 P A -1.8244
63 D A -2.5664
64 S A -1.8278
65 V A 0.0000
66 E A -2.6801
67 G A -1.7447
68 R A 0.0000
69 F A 0.0000
70 T A -0.7892
71 I A 0.0000
72 S A -0.4433
73 R A -1.1633
74 D A -1.8712
75 N A -2.1109
76 A A -1.6110
77 K A -2.6156
78 R A -2.5095
79 M A -1.2105
80 V A 0.0000
81 Y A -0.5548
82 L A 0.0000
83 Q A -1.0911
84 M A 0.0000
85 N A -1.2894
86 S A -1.2189
87 L A 0.0000
88 R A -2.6155
89 A A -1.8997
90 E A -2.3472
91 D A 0.0000
92 T A -0.8955
93 A A 0.0000
94 V A -0.4293
95 Y A 0.0000
96 Y A -0.3025
97 C A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 G A -0.2943
102 S A -0.4307
103 S A -0.2022
104 S A 0.1353
105 V A 0.2369
106 S A -0.0070
107 S A -0.3775
108 G A -0.6279
109 G A 0.0000
110 G A -0.4908
111 V A -1.0286
112 N A -2.3522
113 K A -2.8793
114 E A -2.9044
115 Y A -1.5356
116 A A 0.0000
117 T A -1.6750
118 D A -1.5009
119 P A -0.7222
120 S A -0.2018
121 Y A 0.4365
122 Y A 0.0000
123 S A 0.1473
124 F A 0.1045
125 W A 0.2419
126 G A -0.0496
127 Q A -0.7421
128 G A -0.5357
129 T A -0.7091
130 Q A -0.9842
131 V A 0.0000
132 T A -0.3836
133 V A 0.0000
134 S A -0.8876
135 S A -0.7882
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018