Project name: KFDV_prM

Status: done

Started: 2026-05-19 19:11:52
Settings
Chain sequence(s) A: ATVRRERTGNMVIRAEGKDAATQVEVMNGTCTILATDMGSWCDDSIMYECVTIDSGEEPVDVDCFCKGVERVSLEYGRCGKPAGGRNRRSVSIPVHAHSDLTGRGHKWLKGDSVKTHLTRVEGWVWKNKFLTAAFCAVVWMVTDSLPTRFIVITVALCLAPTYA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)
Show buried residues

Minimal score value
-3.7312
Maximal score value
3.7226
Average score
-0.4906
Total score value
-80.4575

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.8568
2 T A -0.7167
3 V A -1.0983
4 R A -3.1416
5 R A -3.7232
6 E A -3.5585
7 R A -3.1482
8 T A -1.7944
9 G A -2.2456
10 N A -2.8936
11 M A 0.0000
12 V A 0.0000
13 I A 0.0000
14 R A -1.0888
15 A A 0.0000
16 E A -1.3452
17 G A -1.7244
18 K A -2.0035
19 D A -1.3576
20 A A -0.9643
21 A A -0.4700
22 T A -0.7444
23 Q A -1.5549
24 V A 0.0000
25 E A -2.1013
26 V A 0.0000
27 M A -0.0502
28 N A -1.3668
29 G A -1.5548
30 T A -1.5135
31 C A 0.0000
32 T A -0.9180
33 I A 0.0000
34 L A -0.3453
35 A A 0.0000
36 T A -0.5673
37 D A -1.3440
38 M A 0.0000
39 G A 0.0000
40 S A -0.8954
41 W A -0.4792
42 C A -0.8869
43 D A -2.0205
44 D A -1.6107
45 S A -0.7041
46 I A 0.3449
47 M A 0.6071
48 Y A -0.1875
49 E A -2.1551
50 C A 0.0000
51 V A -0.5380
52 T A -1.6581
53 I A 0.0000
54 D A -3.2296
55 S A -2.3753
56 G A -2.4374
57 E A -3.4720
58 E A -2.8676
59 P A -1.1924
60 V A 0.1094
61 D A -1.2114
62 V A -0.4241
63 D A -1.5087
64 C A 0.0000
65 F A 0.0000
66 C A 0.0000
67 K A -2.3015
68 G A -1.8063
69 V A 0.0000
70 E A -3.0772
71 R A -3.1119
72 V A 0.0000
73 S A 0.0000
74 L A 0.0000
75 E A -0.1895
76 Y A 0.0000
77 G A 0.0000
78 R A -1.6019
79 C A -1.2664
80 G A -1.2045
81 K A -2.2392
82 P A -1.1354
83 A A -1.0969
84 G A -1.5161
85 G A -2.4412
86 R A -3.5685
87 N A -3.7312
88 R A -3.6572
89 R A -3.0103
90 S A -0.7527
91 V A 1.3417
92 S A 1.5160
93 I A 2.6175
94 P A 1.4844
95 V A 1.5606
96 H A -0.2105
97 A A -0.7877
98 H A -1.4396
99 S A -1.2293
100 D A -1.5131
101 L A -0.0105
102 T A -0.6706
103 G A -1.2601
104 R A -2.5571
105 G A -2.1396
106 H A -2.1053
107 K A -1.9498
108 W A 0.3385
109 L A 0.7432
110 K A -1.4743
111 G A -1.4659
112 D A -2.2467
113 S A -0.8571
114 V A 0.1014
115 K A -1.9080
116 T A -1.3355
117 H A -1.1635
118 L A -0.7878
119 T A -1.5687
120 R A -2.2646
121 V A 0.0000
122 E A -2.0944
123 G A -1.7007
124 W A -1.1960
125 V A -0.3517
126 W A -0.3781
127 K A -1.3309
128 N A -0.1545
129 K A 0.0197
130 F A 1.9122
131 L A 1.7037
132 T A 1.3375
133 A A 1.3047
134 A A 1.7070
135 F A 2.0719
136 C A 2.2414
137 A A 2.0679
138 V A 2.8851
139 V A 0.0000
140 W A 2.7624
141 M A 2.5429
142 V A 2.4791
143 T A 1.0972
144 D A -0.9482
145 S A -0.1254
146 L A 1.1007
147 P A 1.1047
148 T A 1.3525
149 R A 2.1953
150 F A 3.5703
151 I A 3.7226
152 V A 2.9913
153 I A 2.6434
154 T A 2.3601
155 V A 2.7432
156 A A 2.0041
157 L A 1.2493
158 C A 0.9872
159 L A 1.6227
160 A A 1.0310
161 P A 0.0000
162 T A 0.6672
163 Y A 1.4870
164 A A 0.7908
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018