Project name: obj1 [mutate: IC93C, YD95C, WG110C, TS117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	IC93C,TS117C,YD95C,WG110C
Energy difference between WT (input) and mutated protein (by FoldX)	11.4376 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:41)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -3.2304
• Maximal score value: 1.5458
• Average score: -0.7123
• Total score value: -85.4788

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0045
2	V	C	-1.0690
3	Q	C	-1.4511
4	L	C	0.0000
5	V	C	0.3359
6	E	C	-0.0091
7	S	C	-0.4164
8	G	C	-0.8252
9	G	C	-0.0898
10	G	C	0.8040
11	L	C	1.3746
12	V	C	-0.0962
13	Q	C	-1.3636
14	P	C	-1.5050
15	G	C	-1.4170
16	G	C	-0.9851
17	S	C	-1.2355
18	L	C	-0.9736
19	R	C	-2.1464
20	L	C	0.0000
21	S	C	-0.5423
22	C	C	0.0000
23	A	C	-0.2040
24	A	C	0.0000
25	S	C	-0.2018
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.0734
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.8392
40	A	C	-1.2449
41	P	C	-1.4496
42	G	C	-1.4780
43	K	C	-2.1921
44	G	C	-1.0918
45	L	C	0.2880
46	E	C	-0.4092
47	W	C	0.2760
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3562
61	A	C	-1.1390
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6492
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6697
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4860
88	A	C	-1.9106
89	E	C	-2.3561
90	D	C	0.0000
91	T	C	-0.6101
92	A	C	0.0000
93	C	C	0.3708	mutated: IC93C
94	Y	C	0.0000
95	D	C	-0.2686	mutated: YD95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-2.9588
101	D	C	-3.2304
102	G	C	-2.0089
103	F	C	-1.1471
104	N	C	-2.3438
105	K	C	-3.0428
106	G	C	-1.5843
107	F	C	-0.5547
108	D	C	-1.0482
109	Y	C	-0.5861
110	G	C	-0.6196	mutated: WG110C
111	G	C	-0.8103
112	Q	C	-1.3302
113	G	C	-0.4722
114	T	C	0.3028
115	L	C	1.4243
116	V	C	0.0000
117	S	C	0.1641	mutated: TS117C
118	V	C	0.0000
119	S	C	-0.8077
120	S	C	-1.0752