Project name: EGFR

Status: done

Started: 2026-06-27 04:14:44
Settings
Chain sequence(s) A: DIQMTQSPSSVSASVGDRVTITCRASQGINTWLAWYQQKPGKAPKLLIYAASSLKSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFPLTFGGGTKVEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGFSWVRQAPGQGLEWMGWISASNGNTYYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARVYADYADYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)
Show buried residues

Minimal score value
-3.1266
Maximal score value
1.3696
Average score
-0.6509
Total score value
-155.5644

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.1587
2 I A -1.6135
3 Q A -2.1712
4 M A 0.0000
5 T A -1.3271
6 Q A -0.9113
7 S A -0.7406
8 P A -0.5910
9 S A -0.7768
10 S A -0.8960
11 V A -0.6634
12 S A -1.1365
13 A A 0.0000
14 S A -0.9727
15 V A -0.0162
16 G A -0.7437
17 D A -1.5815
18 R A -2.2426
19 V A 0.0000
20 T A -0.6193
21 I A 0.0000
22 T A -0.8682
23 C A 0.0000
24 R A -2.7921
25 A A 0.0000
26 S A -1.9995
27 Q A -2.4660
28 G A -1.8819
29 I A 0.0000
30 N A -1.7762
31 T A -0.8028
32 W A -0.0982
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.8324
40 P A -1.2472
41 G A -1.6925
42 K A -2.6466
43 A A -1.6262
44 P A 0.0000
45 K A -1.3251
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.3636
50 A A 0.0671
51 A A 0.0000
52 S A -0.2787
53 S A 0.0422
54 L A 0.2300
55 K A -0.3260
56 S A -0.4269
57 G A -0.5336
58 V A -0.3476
59 P A -0.3743
60 S A -0.4462
61 R A -0.7719
62 F A 0.0000
63 S A -0.3187
64 G A -0.2662
65 S A -0.6704
66 G A -1.2128
67 S A -1.3457
68 G A -1.6753
69 T A -1.9891
70 D A -2.1598
71 F A 0.0000
72 T A -0.7544
73 L A 0.0000
74 T A -0.6055
75 I A 0.0000
76 S A -1.2942
77 S A -1.1069
78 L A 0.0000
79 Q A -0.7361
80 P A -1.3206
81 E A -1.9499
82 D A 0.0000
83 F A -0.6054
84 A A 0.0000
85 T A -0.8097
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 A A -0.0645
92 N A -0.7703
93 S A -0.1868
94 F A 0.7204
95 P A 0.0983
96 L A 0.0000
97 T A -0.5407
98 F A -0.2453
99 G A 0.0000
100 G A -1.0895
101 G A 0.0000
102 T A 0.0000
103 K A -1.5040
104 V A 0.0000
105 E A -1.5100
106 I A -1.3366
107 K A -2.0491
108 G A -1.5959
109 G A -1.5005
110 G A -1.3269
111 G A -1.4214
112 S A -1.2433
113 G A -1.6036
114 G A -1.4566
115 G A -1.4391
116 G A -1.3842
117 S A -1.0432
118 G A -1.1685
119 G A -1.3306
120 G A -1.3087
121 G A -1.3724
122 S A -1.3890
123 Q A -1.8473
124 V A -1.0620
125 Q A -1.2415
126 L A 0.0000
127 V A 0.1699
128 Q A 0.0000
129 S A -0.5739
130 G A -0.5536
131 A A 0.1105
132 E A -0.3698
133 V A 0.7735
134 K A -1.0906
135 K A -2.1794
136 P A -2.3214
137 G A -1.7282
138 A A -1.4343
139 S A -1.6231
140 V A 0.0000
141 K A -1.9882
142 V A 0.0000
143 S A -0.4828
144 C A 0.0000
145 K A -0.8952
146 A A 0.0000
147 S A -0.8449
148 G A -0.9585
149 Y A -0.3154
150 T A -0.0951
151 F A 0.0000
152 T A -0.4497
153 S A 0.0516
154 Y A 0.5031
155 G A 0.0000
156 F A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.5039
162 A A -0.8893
163 P A -1.0365
164 G A -1.2220
165 Q A -1.7522
166 G A -1.1268
167 L A 0.0000
168 E A -0.6413
169 W A 0.0000
170 M A 0.0000
171 G A 0.0000
172 W A 0.4303
173 I A 0.0000
174 S A 0.0000
175 A A 0.0000
176 S A -1.1435
177 N A -1.9341
178 G A -1.6862
179 N A -1.6522
180 T A -0.3190
181 Y A 0.7705
182 Y A -0.1098
183 A A 0.0000
184 Q A -2.5207
185 K A -2.6880
186 L A 0.0000
187 Q A -2.2653
188 G A -1.7270
189 R A -1.5485
190 V A 0.0000
191 T A -0.7111
192 M A 0.0000
193 T A -0.3162
194 T A -0.6700
195 D A -0.8736
196 T A -0.5736
197 S A -0.4887
198 T A -0.6197
199 S A -0.6694
200 T A 0.0000
201 A A 0.0000
202 Y A -0.3539
203 M A 0.0000
204 E A -1.1618
205 L A 0.0000
206 R A -1.8738
207 S A -1.6266
208 L A 0.0000
209 R A -3.1266
210 S A -2.3821
211 D A -2.5262
212 D A 0.0000
213 T A -0.7297
214 A A 0.0000
215 V A 0.5772
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 R A 0.0000
221 V A 0.0000
222 Y A 1.3696
223 A A 0.6882
224 D A 0.3390
225 Y A 0.6151
226 A A 0.0000
227 D A 0.0437
228 Y A -0.1094
229 W A -0.4721
230 G A 0.0000
231 Q A -1.3530
232 G A -0.5147
233 T A 0.0000
234 L A 0.9167
235 V A 0.0000
236 T A -0.1843
237 V A 0.0000
238 S A -1.0789
239 S A -0.7847
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018