Project name: 5m_mut

Status: done

Started: 2026-05-26 06:12:22
Settings
Chain sequence(s) A: KPYIDNYLHEKDNDNKIENYNKAEKKQSTSPKESPQIPKDKAKMAGYIEIPDAQIKEPVYPGPATPQQLNRGVSFAEGDESLNQQNISIAGHTFTDRPHYQFTNLKAAKKGSKVYFKVGNQTRKYKITKIHDVKPTEVKVLDEHPSKKNQLTLITCDDYNEQTGVWETRKIFVATQMN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:29)
Show buried residues

Minimal score value
-4.341
Maximal score value
0.8274
Average score
-1.3698
Total score value
-243.8264

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.3268
2 P A -1.0176
3 Y A 0.8274
4 I A 0.7677
5 D A -0.8668
6 N A -0.8107
7 Y A 0.1615
8 L A -0.0282
9 H A -1.3475
10 E A -2.5556
11 K A -3.1902
12 D A -3.6725
13 N A 0.0000
14 D A -4.2499
15 N A -4.3410
16 K A -3.5798
17 I A 0.0000
18 E A -4.0871
19 N A -3.6728
20 Y A -2.7028
21 N A -3.1613
22 K A -3.7814
23 A A -2.8762
24 E A -3.2411
25 K A -4.0658
26 K A -3.7202
27 Q A -3.2523
28 S A -1.7963
29 T A -1.1452
30 S A -1.7789
31 P A -1.7820
32 K A -2.9556
33 E A -3.1250
34 S A -2.1504
35 P A -1.8405
36 Q A -1.8321
37 I A -1.5760
38 P A -2.0624
39 K A -2.9437
40 D A -2.8704
41 K A -2.7425
42 A A -2.1082
43 K A -2.6651
44 M A -1.1472
45 A A 0.0000
46 G A 0.0000
47 Y A -0.2435
48 I A 0.0000
49 E A -1.4705
50 I A 0.0000
51 P A -1.8384
52 D A -2.9351
53 A A 0.0000
54 Q A -2.2382
55 I A 0.0000
56 K A -1.6533
57 E A 0.0000
58 P A 0.0000
59 V A 0.0000
60 Y A 0.0000
61 P A 0.0000
62 G A 0.0000
63 P A -1.4860
64 A A -0.7915
65 T A -0.9578
66 P A -1.3232
67 Q A -1.9480
68 Q A 0.0000
69 L A 0.0000
70 N A -2.1152
71 R A -1.9971
72 G A 0.0000
73 V A 0.0000
74 S A 0.0000
75 F A 0.0000
76 A A -1.0046
77 E A -2.1932
78 G A -2.3583
79 D A -2.5327
80 E A -2.0135
81 S A -1.5954
82 L A 0.0000
83 N A -1.7529
84 Q A -1.4191
85 Q A -2.0649
86 N A 0.0000
87 I A 0.0000
88 S A 0.0000
89 I A 0.0000
90 A A 0.0000
91 G A 0.0000
92 H A -0.4404
93 T A -0.6466
94 F A -0.2741
95 T A -0.9341
96 D A -2.2481
97 R A -1.8090
98 P A -1.1686
99 H A -1.3858
100 Y A -0.9389
101 Q A 0.0000
102 F A 0.0000
103 T A 0.0000
104 N A -1.4310
105 L A 0.0000
106 K A -2.3203
107 A A -1.9185
108 A A 0.0000
109 K A -3.4609
110 K A -3.0532
111 G A -2.3125
112 S A 0.0000
113 K A -2.0975
114 V A 0.0000
115 Y A -0.8186
116 F A 0.0000
117 K A -0.8274
118 V A 0.0000
119 G A -1.7385
120 N A -2.6356
121 Q A -1.4927
122 T A -0.9561
123 R A -1.1165
124 K A -1.6116
125 Y A 0.0000
126 K A -1.9615
127 I A 0.0000
128 T A -1.6728
129 K A -1.6788
130 I A -1.3470
131 H A -1.3288
132 D A -2.5461
133 V A -2.1265
134 K A -2.4348
135 P A -1.3896
136 T A -0.7577
137 E A -0.9083
138 V A 0.2313
139 K A -1.4718
140 V A -0.5449
141 L A -0.9578
142 D A -2.3295
143 E A -2.4691
144 H A -2.4202
145 P A -1.8707
146 S A -1.7136
147 K A -2.8318
148 K A -2.5343
149 N A -2.0914
150 Q A -1.3445
151 L A 0.0000
152 T A 0.0000
153 L A 0.0000
154 I A 0.0000
155 T A 0.0000
156 C A 0.0000
157 D A -1.4733
158 D A -2.4951
159 Y A -1.7039
160 N A -2.1713
161 E A -2.7007
162 Q A -2.1790
163 T A -1.3959
164 G A -1.2958
165 V A -0.9368
166 W A 0.0000
167 E A -2.4573
168 T A -2.1050
169 R A -2.1922
170 K A -2.0260
171 I A 0.0000
172 F A 0.0000
173 V A -0.4881
174 A A 0.0000
175 T A -1.4807
176 Q A -1.5053
177 M A -1.2896
178 N A -1.5488
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018