Project name: 574ac79d6c6a4eb

Chain sequence(s)	A: NFMLTQPHSVSESPGKTVTISCARSSGSIASNYVQWFQQRPGSAPTTVVYEDHQRPSGVPDRFSGSIDSSSNSASLTISGLTADDEADYYCQSYDDSNYYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATVLCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)

• Minimal score value: -3.1991
• Maximal score value: 2.4619
• Average score: -0.7931
• Total score value: -172.1078

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.2139
2	F	A	0.0000
3	M	A	0.8224
4	L	A	0.0000
5	T	A	0.1743
6	Q	A	0.0000
7	P	A	-0.6671
8	H	A	-1.1599
9	S	A	-0.8625
10	V	A	-0.4422
11	S	A	-0.6947
12	E	A	-1.0937
13	S	A	-1.0510
14	P	A	-1.0934
15	G	A	-1.4184
16	K	A	-1.9252
17	T	A	-1.1756
18	V	A	0.0000
19	T	A	-0.1793
20	I	A	0.0000
21	S	A	-0.2631
22	C	A	0.0000
23	A	A	-0.3100
24	R	A	-0.3204
25	S	A	-0.3853
26	S	A	-0.6662
27	G	A	-1.0028
28	S	A	-0.8711
29	I	A	0.0000
30	A	A	-0.2378
31	S	A	-0.4793
32	N	A	-0.4944
33	Y	A	0.4908
34	V	A	0.0000
35	Q	A	-0.2093
36	W	A	0.0000
37	F	A	0.1966
38	Q	A	0.0000
39	Q	A	-1.1436
40	R	A	-1.6881
41	P	A	-1.1218
42	G	A	-0.8701
43	S	A	-0.7195
44	A	A	-0.4140
45	P	A	-0.5223
46	T	A	-0.1861
47	T	A	-0.0089
48	V	A	0.0000
49	V	A	0.0000
50	Y	A	-0.8623
51	E	A	-1.4701
52	D	A	-1.2061
53	H	A	-1.8020
54	Q	A	-2.0649
55	R	A	-1.7194
56	P	A	-0.6748
57	S	A	-0.7854
58	G	A	-0.7918
59	V	A	-0.8380
60	P	A	-1.3198
61	D	A	-2.3460
62	R	A	-1.5736
63	F	A	0.0000
64	S	A	-1.2281
65	G	A	-1.0149
66	S	A	-0.9214
67	I	A	-0.3735
68	D	A	-1.2260
69	S	A	-0.9625
70	S	A	-0.7919
71	S	A	-0.8019
72	N	A	-0.9487
73	S	A	0.0000
74	A	A	0.0000
75	S	A	-0.4484
76	L	A	0.0000
77	T	A	-0.3041
78	I	A	0.0000
79	S	A	-1.1852
80	G	A	-1.2628
81	L	A	0.0000
82	T	A	-1.2182
83	A	A	-1.1997
84	D	A	-2.1152
85	D	A	0.0000
86	E	A	-1.8369
87	A	A	0.0000
88	D	A	-1.2254
89	Y	A	0.0000
90	Y	A	0.3464
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	Y	A	0.5687
95	D	A	0.0000
96	D	A	-2.1550
97	S	A	-1.1958
98	N	A	-0.8948
99	Y	A	1.0847
100	Y	A	2.0358
101	V	A	1.8999
102	F	A	2.4619
103	G	A	0.9912
104	T	A	0.2891
105	G	A	0.0000
106	T	A	0.0000
107	K	A	-1.1006
108	V	A	0.0000
109	T	A	0.0000
110	V	A	-0.9462
111	L	A	-0.7623
112	G	A	-0.8414
113	Q	A	-1.1656
114	P	A	-1.4139
115	K	A	-2.4439
116	A	A	-1.8371
117	N	A	-1.9839
118	P	A	-0.8947
119	T	A	-0.3617
120	V	A	0.0000
121	T	A	0.1115
122	L	A	0.4635
123	F	A	1.1590
124	P	A	0.2244
125	P	A	0.0000
126	S	A	-1.0352
127	S	A	-1.7907
128	E	A	-2.8706
129	E	A	-2.5960
130	L	A	-2.2932
131	Q	A	-2.5602
132	A	A	-2.2326
133	N	A	-2.9220
134	K	A	-3.1869
135	A	A	0.0000
136	T	A	-0.1298
137	V	A	0.0000
138	L	A	0.9789
139	C	A	0.0000
140	L	A	0.9279
141	I	A	0.0000
142	S	A	-0.6071
143	D	A	-1.7299
144	F	A	0.0000
145	Y	A	0.0000
146	P	A	0.0000
147	G	A	0.0000
148	A	A	-0.4976
149	V	A	-0.2552
150	T	A	-0.0902
151	V	A	-0.0747
152	A	A	-0.5782
153	W	A	0.0000
154	K	A	-1.4597
155	A	A	0.0000
156	D	A	-1.7087
157	G	A	-1.3341
158	S	A	-0.8494
159	P	A	-1.0215
160	V	A	-0.9894
161	K	A	-1.9076
162	A	A	-1.0650
163	G	A	-0.9515
164	V	A	-1.0539
165	E	A	-1.9955
166	T	A	-1.0331
167	T	A	-1.3102
168	K	A	-2.1171
169	P	A	-1.3728
170	S	A	-1.7707
171	K	A	-2.8677
172	Q	A	-2.2743
173	S	A	-1.8788
174	N	A	-2.5385
175	N	A	-2.8027
176	K	A	-2.5507
177	Y	A	-1.7615
178	A	A	-0.9925
179	A	A	0.0000
180	S	A	-0.1638
181	S	A	0.0000
182	Y	A	0.3115
183	L	A	0.0000
184	S	A	-0.6434
185	L	A	-1.1991
186	T	A	-1.9991
187	P	A	0.0000
188	E	A	-3.1991
189	Q	A	-2.5448
190	W	A	0.0000
191	K	A	-3.0987
192	S	A	-2.4589
193	H	A	-2.4285
194	R	A	-2.6009
195	S	A	-1.9167
196	Y	A	0.0000
197	S	A	-1.1839
198	C	A	0.0000
199	Q	A	-1.1709
200	V	A	0.0000
201	T	A	-0.6447
202	H	A	0.0000
203	E	A	-1.6492
204	G	A	-1.0013
205	S	A	-0.7823
206	T	A	-0.7585
207	V	A	-0.9543
208	E	A	-2.2055
209	K	A	-1.6395
210	T	A	-1.0480
211	V	A	0.0000
212	A	A	-1.5303
213	P	A	-1.6116
214	T	A	-1.5635
215	E	A	-1.8101
216	C	A	-0.7100
217	S	A	-0.6658