Project name: query_structure

Status: done

Started: 2026-03-16 22:49:52
Settings
Chain sequence(s) A: VYPKKTHWTAEITPNLHGTEVVVAGWVEDLVDAGKTKWVFVCDREGGAQVIVELVAGKTPDHLFKVFAELSREDVVVIKGIVEASKSRAVGVEIFPSEIWILNKAKPLPID
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:38)
Show buried residues

Minimal score value
-3.2521
Maximal score value
2.1654
Average score
-0.904
Total score value
-100.3434

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 2.1654
2 Y A 1.6677
3 P A -0.1103
4 K A -1.5452
5 K A -1.2162
6 T A -1.1661
7 H A -0.7250
8 W A -0.7791
9 T A 0.0000
10 A A -1.3323
11 E A -1.4848
12 I A 0.0000
13 T A -1.1824
14 P A -1.5263
15 N A -1.9398
16 L A -1.5738
17 H A -1.9377
18 G A -1.4663
19 T A -1.4028
20 E A -1.8789
21 V A 0.0000
22 V A 0.0000
23 V A 0.0000
24 A A -0.1759
25 G A 0.0000
26 W A -0.7125
27 V A 0.0000
28 E A -1.9199
29 D A -1.5717
30 L A -0.5996
31 V A -0.2439
32 D A -1.7914
33 A A -1.2701
34 G A -1.7139
35 K A -2.1846
36 T A -1.2395
37 K A -0.8656
38 W A 0.0759
39 V A 0.0000
40 F A -0.3605
41 V A 0.0000
42 C A -1.1254
43 D A 0.0000
44 R A -2.4632
45 E A -2.5082
46 G A -1.9791
47 G A -1.4757
48 A A -1.2498
49 Q A -1.2801
50 V A 0.0000
51 I A 0.0000
52 V A 0.0000
53 E A 0.0000
54 L A 0.0000
55 V A -1.0453
56 A A -1.5610
57 G A -1.7406
58 K A -2.0665
59 T A 0.0000
60 P A -1.9206
61 D A -2.7996
62 H A -2.3852
63 L A 0.0000
64 F A -1.6873
65 K A -2.4359
66 V A -1.3508
67 F A 0.0000
68 A A -1.3135
69 E A -1.9271
70 L A 0.0000
71 S A -2.2174
72 R A -3.1767
73 E A -3.2521
74 D A 0.0000
75 V A -0.4166
76 V A 0.0000
77 V A 0.0000
78 I A 0.0000
79 K A -0.9941
80 G A 0.0000
81 I A -0.4444
82 V A 0.0000
83 E A -1.4743
84 A A -1.4645
85 S A -1.5859
86 K A -2.2965
87 S A -1.8009
88 R A -2.2938
89 A A -1.0440
90 V A -0.8944
91 G A -1.3240
92 V A 0.0000
93 E A 0.0000
94 I A 0.0000
95 F A -0.2055
96 P A 0.0000
97 S A -0.9214
98 E A -0.7106
99 I A 0.0000
100 W A 0.8955
101 I A 0.3965
102 L A 0.3367
103 N A -1.7541
104 K A -3.0967
105 A A -2.5427
106 K A -2.5533
107 P A -0.9419
108 L A 0.4267
109 P A 0.6380
110 I A 1.3983
111 D A -0.7073
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018