Project name: MPZ_WT

Status: done

Started: 2026-02-20 15:30:15
Settings
Chain sequence(s) A: IVVYTDREVHGAVGSRVTLHHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:01)
Show buried residues

Minimal score value
-3.3754
Maximal score value
2.0644
Average score
-0.7201
Total score value
-87.1296

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A 1.9471
2 V A 1.8963
3 V A 1.0623
4 Y A 0.3510
5 T A -1.4512
6 D A -3.0977
7 R A -3.3754
8 E A -2.5508
9 V A -1.3187
10 H A -0.4905
11 G A 0.0000
12 A A -0.8370
13 V A -1.1194
14 G A -1.7448
15 S A -1.8784
16 R A -2.5292
17 V A -1.1563
18 T A -0.7376
19 L A 0.0000
20 H A -1.1029
21 C A 0.0000
22 S A 0.5229
23 F A 0.0000
24 W A 2.0010
25 S A 1.0505
26 S A -0.0893
27 E A -0.7968
28 W A 0.3987
29 V A 0.1521
30 S A -1.1910
31 D A -2.8645
32 D A -2.6809
33 I A 0.0000
34 S A -1.4759
35 F A 0.0000
36 T A 0.0000
37 W A 0.0000
38 R A -1.1411
39 Y A 0.0000
40 Q A -2.0890
41 P A -2.0248
42 E A -2.5063
43 G A -2.1679
44 G A -2.5499
45 R A -3.2129
46 D A -2.8398
47 A A -1.4432
48 I A -0.5209
49 S A -0.4881
50 I A 0.0000
51 F A 0.0000
52 H A -0.2806
53 Y A 0.0000
54 A A -1.6990
55 K A -2.7310
56 G A -2.3607
57 Q A -1.6198
58 P A -0.4238
59 Y A 0.4917
60 I A -0.0436
61 D A -1.1099
62 E A -1.8055
63 V A 0.1523
64 G A -0.3339
65 T A -0.5672
66 F A 0.0000
67 K A -2.1444
68 E A -2.8091
69 R A -2.2992
70 I A -1.3720
71 Q A -0.6183
72 W A 0.4205
73 V A 0.5783
74 G A -0.0138
75 D A 0.0000
76 P A -1.7150
77 R A -2.0542
78 W A -0.0866
79 K A -0.5723
80 D A -0.1629
81 G A 0.0000
82 S A 0.0000
83 I A 0.0000
84 V A 0.0000
85 I A 0.0000
86 H A -2.1909
87 N A -2.5529
88 L A 0.0000
89 D A -1.2780
90 Y A 0.5940
91 S A -0.1815
92 D A 0.0000
93 N A -0.4826
94 G A 0.0000
95 T A -1.4943
96 F A 0.0000
97 T A -1.0482
98 C A 0.0000
99 D A -0.9794
100 V A 0.0000
101 K A -0.6544
102 N A -1.1880
103 P A -0.9603
104 P A -0.5590
105 D A 0.1383
106 I A 2.0644
107 V A 1.7433
108 G A 0.0879
109 K A -0.8417
110 T A -0.7912
111 S A -1.1120
112 Q A -2.1252
113 V A 0.0000
114 T A -1.6301
115 L A 0.0000
116 Y A 0.3542
117 V A 0.0000
118 F A -0.0796
119 E A -1.7676
120 K A -1.5357
121 V A 0.6112
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018