Project name: Snapf

Status: done

Started: 2026-07-15 16:13:36
Settings
Chain sequence(s) A: MDKDCEMKRTTLDSPLGKLELSGCEQGLHRIIFLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKPGLG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-3.1541
Maximal score value
1.4774
Average score
-0.7151
Total score value
-130.1438

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.4019
2 D A -2.1862
3 K A -3.0209
4 D A -3.1541
5 C A -2.8074
6 E A -3.0027
7 M A -1.5473
8 K A -1.8407
9 R A -1.2930
10 T A -0.2763
11 T A -0.4434
12 L A -1.0850
13 D A -2.3008
14 S A 0.0000
15 P A -0.8748
16 L A 0.0000
17 G A -1.4493
18 K A -1.9165
19 L A 0.0000
20 E A 0.0000
21 L A 0.0000
22 S A -0.7621
23 G A 0.0000
24 C A 0.0000
25 E A -2.9302
26 Q A -1.9034
27 G A 0.0000
28 L A 0.0000
29 H A 0.0000
30 R A -0.8925
31 I A 0.0000
32 I A 0.0949
33 F A -0.4887
34 L A -0.4834
35 G A -1.4225
36 K A -2.2504
37 G A -1.5742
38 T A -1.1861
39 S A -1.0207
40 A A -0.5408
41 A A -0.7556
42 D A -1.8323
43 A A -0.8993
44 V A -0.4574
45 E A -1.3391
46 V A 0.0794
47 P A -0.3645
48 A A -0.1699
49 P A -0.0404
50 A A 0.0560
51 A A 0.7993
52 V A 1.2764
53 L A 1.4774
54 G A 0.3314
55 G A -0.5808
56 P A 0.0000
57 E A -2.0314
58 P A 0.0000
59 L A 0.0000
60 M A 0.1400
61 Q A -0.0103
62 A A 0.0000
63 T A -0.2624
64 A A 0.0721
65 W A 0.0000
66 L A 0.0000
67 N A -1.2148
68 A A 0.0000
69 Y A 0.0000
70 F A 0.0000
71 H A -1.7853
72 Q A -2.1956
73 P A -2.2178
74 E A -2.8689
75 A A -2.3638
76 I A 0.0000
77 E A -2.6962
78 E A -2.5966
79 F A -0.7594
80 P A -0.1474
81 V A 0.7489
82 P A 0.0000
83 A A -0.2740
84 L A -0.2205
85 H A -0.6893
86 H A -0.4431
87 P A -0.3522
88 V A -0.8156
89 F A 0.0000
90 Q A -1.5195
91 Q A -2.2974
92 E A -2.5540
93 S A -1.2966
94 F A -0.5605
95 T A -0.6773
96 R A -1.1045
97 Q A -0.7683
98 V A 0.0000
99 L A 0.0000
100 W A -0.3253
101 K A -0.6613
102 L A 0.0000
103 L A -0.5811
104 K A -1.3677
105 V A -0.3531
106 V A 0.0000
107 K A -1.8148
108 F A -1.0043
109 G A -1.3063
110 E A -1.2921
111 V A 0.0000
112 I A 0.0000
113 S A 0.0000
114 Y A 0.0000
115 S A -0.5675
116 H A -0.3619
117 L A 0.0000
118 A A 0.0000
119 A A -0.5904
120 L A -0.1327
121 A A -0.6231
122 G A -1.0483
123 N A -1.4974
124 P A -0.9528
125 A A -0.5650
126 A A -0.6584
127 T A -0.7463
128 A A -0.4667
129 A A -0.5434
130 V A 0.0000
131 K A -1.6200
132 T A -0.9311
133 A A 0.0000
134 L A 0.0000
135 S A -1.2172
136 G A -0.9081
137 N A 0.0000
138 P A 0.0000
139 V A 0.0000
140 P A 0.0000
141 I A 0.0000
142 L A 0.0000
143 I A 0.0000
144 P A 0.0000
145 C A 0.0000
146 H A 0.0000
147 R A 0.0000
148 V A 0.0000
149 V A 0.0000
150 Q A -1.7025
151 G A -1.5667
152 D A -2.1457
153 L A -1.0744
154 D A -1.7368
155 V A -0.7500
156 G A -0.8358
157 G A -0.8673
158 Y A -0.6155
159 E A -1.0953
160 G A -0.6823
161 G A -0.2917
162 L A 1.0234
163 A A 0.5019
164 V A 0.0000
165 K A 0.0000
166 E A -0.5857
167 W A -0.0170
168 L A 0.0000
169 L A 0.0000
170 A A -0.8451
171 H A -0.6217
172 E A 0.0000
173 G A -1.1315
174 H A -1.8568
175 R A -2.4690
176 L A -1.6550
177 G A -1.6036
178 K A -2.4878
179 P A -1.7576
180 G A -1.2811
181 L A -0.1158
182 G A -0.5996
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018