Project name: SARS

Status: done

Started: 2025-07-17 05:17:17
Settings
Chain sequence(s) E: CPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
input PDB
Selected Chain(s) E
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with E chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:00)
Show buried residues

Minimal score value
-2.9731
Maximal score value
1.7302
Average score
-0.3458
Total score value
-60.1737

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
323 C E 0.7049
324 P E -0.4385
325 F E 0.0000
326 G E -1.4611
327 E E -2.4131
328 V E 0.0000
329 F E 0.0000
330 N E -2.1807
331 A E -1.8315
332 T E -1.1822
333 K E -1.7013
334 F E 0.0000
335 P E -0.9842
336 S E -0.7076
337 V E 0.0000
338 Y E 0.0000
339 A E -0.2711
340 W E 0.0000
341 E E -2.1569
342 R E -1.9743
343 K E -2.4216
344 K E -2.1026
345 I E 0.0000
346 S E -1.1903
347 N E -0.8968
348 C E 0.4512
349 V E 1.2729
350 A E 0.2069
351 D E -0.9635
352 Y E -0.0450
353 S E -0.0349
354 V E 1.2289
355 L E 0.0000
356 Y E -0.0137
357 N E -0.5615
358 S E 0.2888
359 T E 0.7071
360 F E 1.7131
361 F E 1.0099
362 S E 0.1478
363 T E -0.3000
364 F E -0.1676
365 K E -1.1904
366 C E -0.1012
367 Y E 0.2829
368 G E 0.6502
369 V E 1.4030
370 S E 0.3042
371 A E 0.1729
372 T E -0.7999
373 K E -1.6144
374 L E -0.0087
375 N E -0.8724
382 V E -0.2809
383 Y E -0.5064
384 A E 0.0000
385 D E 0.0000
386 S E 0.0000
387 F E 0.0000
388 V E 0.0000
389 V E 0.0000
390 K E -0.1617
391 G E -0.1732
392 D E -0.9894
393 D E -1.0210
394 V E -1.1941
395 R E -2.2493
396 Q E -1.4095
397 I E 0.0000
398 A E 0.0000
399 P E -1.3209
400 G E -1.6396
401 Q E -1.4863
402 T E -0.6986
403 G E -0.1582
404 V E 0.6500
405 I E 0.0000
406 A E 0.0000
407 D E -0.8579
408 Y E -0.9217
409 N E 0.0000
410 Y E 0.0000
411 K E -1.6366
412 L E 0.0000
413 P E 0.0000
414 D E -2.4854
415 D E -1.7738
416 F E 0.8388
417 M E 0.5770
418 G E 0.0000
419 C E 0.0000
420 V E 0.0000
421 L E 0.0000
422 A E 0.0000
423 W E 0.0000
424 N E -0.2831
425 T E 0.0000
426 R E -0.7286
427 N E -0.9074
428 I E 0.8089
429 D E 0.0000
430 A E -0.1111
431 T E -0.0096
432 S E -0.4271
433 T E -0.0368
434 G E 0.0341
435 N E 0.0275
436 Y E -0.0563
437 N E -1.1664
438 Y E 0.0000
439 K E -1.1466
440 Y E -0.1698
441 R E 0.0000
442 Y E 0.8576
443 L E 0.2195
444 R E -1.0389
445 H E -2.0610
446 G E -2.0860
447 K E -2.7310
448 L E 0.0000
449 R E -2.9306
450 P E -1.9917
451 F E -1.1601
452 E E -2.8252
453 R E -2.2053
454 D E -0.5710
455 I E 1.3537
456 S E 0.5358
457 N E 0.3851
458 V E 1.7267
459 P E 0.9299
460 F E -0.0413
461 S E 0.0000
462 P E -1.9092
463 D E -2.9731
464 G E -2.4780
465 K E -2.7428
466 P E -1.1242
467 C E -0.0814
468 T E -0.1673
469 P E 0.1945
470 P E 0.1489
471 A E 0.4370
472 L E 1.0036
473 N E -0.7565
474 C E 0.3819
475 Y E 1.4497
476 W E 1.5597
477 P E 0.0000
478 L E 0.2563
479 N E -0.8047
480 D E -1.7273
481 Y E -0.6076
482 G E -0.1709
483 F E 0.0000
484 Y E 0.4140
485 T E 0.0596
486 T E 0.2015
487 T E 0.5721
488 G E 0.8277
489 I E 1.7302
490 G E 0.8315
491 Y E 1.3471
492 Q E 0.4199
493 P E 0.0000
494 Y E 0.0000
495 R E 0.0000
496 V E 0.0000
497 V E 0.0000
498 V E 0.0000
499 L E 0.0000
500 S E 0.6481
501 F E 0.7038
502 E E -1.0707
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018