Project name: 58f422bc50e892a

Status: done

Started: 2025-10-09 15:32:54
Settings
Chain sequence(s) A: MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRMFIDSLTIAGEKLDKNIVAIDGGEDVTKADSATAAASVIRMSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMIDLSNLELYPISAKAFSISIEPTELMGVSKDGMRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:43)
Show buried residues

Minimal score value
-3.3396
Maximal score value
2.5026
Average score
-0.7354
Total score value
-152.2207

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 M A 0.7648
4 S A 0.2079
5 E A -0.0113
6 M A -0.3319
7 I A 0.0000
8 T A -0.8741
9 R A -1.9582
10 Q A -2.2064
11 Q A -1.9373
12 V A -1.2465
13 T A -1.2564
14 S A -1.5089
15 G A -1.9343
16 E A -2.3844
17 T A -1.1962
18 I A 0.0000
19 H A -1.3178
20 V A 0.0000
21 R A -2.8973
22 T A -2.3387
23 D A -2.5907
24 P A -1.0974
25 T A -0.2034
26 A A 0.0000
27 C A 0.0000
28 I A 0.6283
29 G A -0.2172
30 S A -0.8550
31 H A -0.9796
32 P A -0.9610
33 N A -1.6333
34 C A -1.1749
35 R A 0.0000
36 M A 0.0000
37 F A 0.0000
38 I A 0.0000
39 D A -1.5497
40 S A -1.8578
41 L A 0.0000
42 T A -1.8070
43 I A 0.0000
44 A A 0.0000
45 G A -1.8610
46 E A -2.5686
47 K A -2.9311
48 L A 0.0000
49 D A -3.0111
50 K A -2.4331
51 N A -1.2799
52 I A 0.0000
53 V A 0.1970
54 A A 0.0000
55 I A 0.0000
56 D A -1.2635
57 G A 0.0000
58 G A -1.5280
59 E A -2.2066
60 D A -2.1870
61 V A -1.1221
62 T A -1.4349
63 K A -2.5338
64 A A -1.8355
65 D A -2.0731
66 S A -1.2658
67 A A -0.8806
68 T A -0.6113
69 A A 0.0000
70 A A 0.0000
71 A A 0.0000
72 S A 0.0000
73 V A 0.0000
74 I A 0.0000
75 R A -2.5554
76 M A 0.0000
77 S A -0.9581
78 I A 0.0000
79 T A -0.7809
80 P A -0.7640
81 G A -0.1387
82 S A 0.8632
83 I A 2.2682
84 N A 0.6593
85 P A 0.0000
86 T A -0.3001
87 I A 0.0000
88 S A -0.8413
89 I A 0.0000
90 T A 0.0000
91 L A 0.0000
92 G A 0.0000
93 V A 0.0000
94 L A -0.3804
95 I A 0.0000
96 K A -1.3048
97 S A -1.6773
98 N A -1.9995
99 V A -1.8072
100 R A -2.2121
101 T A -2.4218
102 K A -3.3396
103 I A 0.0000
104 E A -2.5018
105 E A -3.2737
106 K A -2.7389
107 V A 0.0000
108 S A -1.5656
109 S A -1.3377
110 I A -1.1981
111 L A -1.3209
112 Q A -1.3158
113 A A -0.7859
114 S A -0.9569
115 A A -0.9771
116 T A -0.8916
117 D A -1.9807
118 M A 0.0000
119 K A -1.6431
120 I A 0.0000
121 K A -1.6974
122 L A 0.0000
123 G A -1.6057
124 N A -2.1208
125 S A 0.0000
126 N A 0.0000
127 K A -2.3708
128 K A -1.8509
129 Q A 0.0000
130 E A -0.5506
131 Y A -0.3388
132 K A 0.0000
133 T A -0.9226
134 D A -1.7754
135 E A -2.0763
136 A A -1.0670
137 W A -0.7496
138 G A 0.0000
139 I A -0.8282
140 M A 0.0000
141 I A 0.0000
142 D A -0.7515
143 L A 0.0000
144 S A -1.7990
145 N A -2.1222
146 L A 0.0000
147 E A -1.7136
148 L A 0.0000
149 Y A -0.5282
150 P A 0.0000
151 I A 0.5543
152 S A -0.2307
153 A A -0.8799
154 K A -1.6679
155 A A -0.8084
156 F A 0.0000
157 S A -0.7014
158 I A -0.2850
159 S A -0.5834
160 I A 0.0000
161 E A -1.3395
162 P A -1.2126
163 T A -0.7440
164 E A -1.0690
165 L A 0.3919
166 M A 0.5135
167 G A 0.0869
168 V A 0.6286
169 S A -0.5722
170 K A -1.9080
171 D A -1.8227
172 G A -0.9176
173 M A -0.6722
174 R A -0.7196
175 Y A 0.0000
176 H A 0.0000
177 I A -0.2978
178 I A 0.0000
179 S A -0.5942
180 I A 0.0000
181 D A -1.0334
182 G A -0.5234
183 L A 0.0000
184 T A 0.0000
185 T A 0.0000
186 S A 0.0636
187 Q A -0.6109
188 G A 0.5858
189 S A -0.0496
190 L A 0.0000
191 P A -0.0597
192 V A 0.0000
193 C A 0.0000
194 C A 0.0000
195 A A -0.5391
196 A A -1.0430
197 S A -0.9511
198 T A -0.9965
199 D A -1.5865
200 K A -1.7841
201 G A -0.5387
202 V A 0.8819
203 A A 0.0000
204 K A -0.9830
205 I A 0.0000
206 G A 0.0000
207 Y A 2.4074
208 I A 2.5026
209 A A 1.4905
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018