Project name: 5910508a705bad8

Chain sequence(s)	A: DNGNLWTFIGKAIGSTARSWAEGAMFAPAIGPAKEIVDKLNGN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)

• Minimal score value: -3.089
• Maximal score value: 2.1775
• Average score: -0.3791
• Total score value: -16.3033

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-2.5453
2	N	A	-1.8440
3	G	A	-1.1989
4	N	A	-0.9762
5	L	A	0.7026
6	W	A	1.1317
7	T	A	0.9359
8	F	A	2.0841
9	I	A	1.9942
10	G	A	0.7225
11	K	A	-0.1722
12	A	A	0.6368
13	I	A	1.3692
14	G	A	-0.2469
15	S	A	-0.7302
16	T	A	-0.5069
17	A	A	-0.8153
18	R	A	-2.1319
19	S	A	-1.4152
20	W	A	-0.3112
21	A	A	-0.9756
22	E	A	-1.7956
23	G	A	-0.1142
24	A	A	0.6664
25	M	A	1.7014
26	F	A	2.1775
27	A	A	1.2284
28	P	A	0.8322
29	A	A	0.9781
30	I	A	1.1966
31	G	A	-0.3554
32	P	A	-0.7187
33	A	A	-0.5377
34	K	A	-1.8628
35	E	A	-2.4421
36	I	A	-0.2166
37	V	A	-0.4547
38	D	A	-3.0890
39	K	A	-2.4393
40	L	A	-0.4550
41	N	A	-2.0187
42	G	A	-1.9232
43	N	A	-2.3681