Project name: 5910508a705bad8

Status: done

Started: 2026-05-15 06:10:55
Settings
Chain sequence(s) A: DNGNLWTFIGKAIGSTARSWAEGAMFAPAIGPAKEIVDKLNGN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)
Show buried residues

Minimal score value
-3.089
Maximal score value
2.1775
Average score
-0.3791
Total score value
-16.3033

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.5453
2 N A -1.8440
3 G A -1.1989
4 N A -0.9762
5 L A 0.7026
6 W A 1.1317
7 T A 0.9359
8 F A 2.0841
9 I A 1.9942
10 G A 0.7225
11 K A -0.1722
12 A A 0.6368
13 I A 1.3692
14 G A -0.2469
15 S A -0.7302
16 T A -0.5069
17 A A -0.8153
18 R A -2.1319
19 S A -1.4152
20 W A -0.3112
21 A A -0.9756
22 E A -1.7956
23 G A -0.1142
24 A A 0.6664
25 M A 1.7014
26 F A 2.1775
27 A A 1.2284
28 P A 0.8322
29 A A 0.9781
30 I A 1.1966
31 G A -0.3554
32 P A -0.7187
33 A A -0.5377
34 K A -1.8628
35 E A -2.4421
36 I A -0.2166
37 V A -0.4547
38 D A -3.0890
39 K A -2.4393
40 L A -0.4550
41 N A -2.0187
42 G A -1.9232
43 N A -2.3681
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018