Project name: query_structure

Status: done

Started: 2026-03-16 23:47:55
Settings
Chain sequence(s) A: HHQELCTKGDDALVTELECIRLRISPETNAAFDNAVQQLNCLNRACAYRKMCATNNLEQAMSVYFTNEQIKEIHDAATACDPEAHHEHDH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)
Show buried residues

Minimal score value
-4.4112
Maximal score value
1.8016
Average score
-1.3244
Total score value
-119.1963

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 H A -2.1692
2 H A -2.4746
3 Q A -2.5762
4 E A -2.7794
5 L A -1.4285
6 C A 0.0000
7 T A -2.0832
8 K A -2.4497
9 G A -2.4701
10 D A -2.6821
11 D A -2.6062
12 A A -1.6891
13 L A 0.0000
14 V A -0.3895
15 T A -0.8501
16 E A 0.0000
17 L A -0.7597
18 E A -1.4997
19 C A -0.6239
20 I A -1.2966
21 R A -2.4567
22 L A -0.6980
23 R A -2.1726
24 I A -1.4691
25 S A -1.2906
26 P A -1.6644
27 E A -1.2827
28 T A 0.0000
29 N A -2.5989
30 A A -1.0829
31 A A 0.0000
32 F A 0.0000
33 D A -2.2824
34 N A -1.4760
35 A A 0.0000
36 V A 0.0000
37 Q A -2.1806
38 Q A -1.9134
39 L A -1.3192
40 N A -1.5479
41 C A -0.1737
42 L A 0.3132
43 N A -0.4707
44 R A -1.4810
45 A A 0.0000
46 C A -0.3799
47 A A 0.0000
48 Y A -0.9778
49 R A -1.2743
50 K A -1.8415
51 M A -1.3950
52 C A -0.7282
53 A A -1.3797
54 T A -1.4176
55 N A -2.1573
56 N A -1.9527
57 L A 0.0000
58 E A -1.0982
59 Q A -1.1935
60 A A -0.2882
61 M A 0.0000
62 S A 0.3100
63 V A 1.8016
64 Y A 1.5824
65 F A 0.0000
66 T A -0.9560
67 N A -2.2251
68 E A -3.3624
69 Q A -2.1442
70 I A -2.1110
71 K A -3.3632
72 E A -3.2358
73 I A 0.0000
74 H A -2.4366
75 D A 0.0000
76 A A 0.0000
77 A A 0.0000
78 T A -0.4067
79 A A -0.3993
80 C A -0.4842
81 D A -1.2116
82 P A -1.9092
83 E A -2.4655
84 A A -1.7156
85 H A -2.8706
86 H A -3.7551
87 E A -4.4112
88 H A -3.3744
89 D A -3.5679
90 H A -2.3254
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018