Project name: query_structure

Status: done

Started: 2026-03-16 21:46:46
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIAYWEPGIGGEAIWLRVPGSERSYDLTGLKPGTEYKVWIHGVKGGAASPPLIARFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)
Show buried residues

Minimal score value
-3.0205
Maximal score value
1.2415
Average score
-0.6991
Total score value
-62.916

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.1128
2 L A 0.5000
3 P A -0.1577
4 A A -0.4428
5 P A 0.0000
6 K A -2.0259
7 N A -1.1996
8 L A 0.2175
9 V A 0.9431
10 V A 0.0588
11 S A -0.5936
12 R A -1.9937
13 V A -0.9860
14 T A -1.7497
15 E A -2.9831
16 D A -2.6368
17 S A -2.0154
18 A A 0.0000
19 R A -1.1711
20 L A 0.0000
21 S A -0.3743
22 W A 0.0000
23 T A -1.2996
24 A A -1.4286
25 P A -1.4092
26 D A -2.2901
27 A A -1.4398
28 A A -1.1815
29 F A 0.0000
30 D A -2.4574
31 S A 0.0000
32 F A 0.0000
33 N A -0.5685
34 I A 0.0000
35 A A 0.0000
36 Y A 0.4696
37 W A -0.2502
38 E A -1.0212
39 P A -0.7691
40 G A 0.0870
41 I A 1.2280
42 G A -0.1486
43 G A -0.4613
44 E A -1.2934
45 A A -0.1057
46 I A 1.0922
47 W A 1.1536
48 L A 0.1511
49 R A -1.5748
50 V A 0.0000
51 P A -1.5569
52 G A 0.0000
53 S A -1.6613
54 E A -1.6055
55 R A -1.2156
56 S A -0.6800
57 Y A -0.7391
58 D A -1.6325
59 L A 0.0000
60 T A -1.3973
61 G A -1.4609
62 L A 0.0000
63 K A -3.0205
64 P A -2.5669
65 G A -1.9289
66 T A -2.0765
67 E A -2.6670
68 Y A 0.0000
69 K A -1.0402
70 V A 0.0000
71 W A 0.8788
72 I A 0.0000
73 H A -0.2841
74 G A 0.0000
75 V A -1.1903
76 K A -1.6990
77 G A -1.4001
78 G A -1.1047
79 A A -0.5095
80 A A -0.1251
81 S A 0.0000
82 P A 0.2815
83 P A 0.2110
84 L A 0.5254
85 I A 1.2415
86 A A 0.0976
87 R A -1.7673
88 F A 0.0000
89 T A -1.8243
90 T A -1.9833
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018