Project name: 597ec3bcc078c0d

Chain sequence(s)	A: HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYSEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:50)

• Minimal score value: -4.4373
• Maximal score value: 1.5524
• Average score: -1.2541
• Total score value: -198.145

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	H	A	-1.0315
2	H	A	-0.6255
3	L	A	0.6213
4	L	A	0.3996
5	A	A	0.0000
6	S	A	-2.3800
7	D	A	-3.1464
8	E	A	-4.0873
9	E	A	-4.4373
10	I	A	0.0000
11	Q	A	-3.5320
12	D	A	-3.2672
13	V	A	0.0000
14	S	A	-1.1790
15	G	A	-0.6106
16	T	A	-0.6163
17	W	A	-0.5906
18	Y	A	-0.8743
19	L	A	0.0000
20	K	A	-0.2348
21	A	A	0.0000
22	M	A	0.7573
23	T	A	0.0000
24	V	A	-0.5776
25	D	A	-1.7072
26	R	A	-2.8344
27	E	A	-2.5313
28	F	A	-0.6982
29	P	A	-1.5745
30	E	A	-1.8743
31	M	A	-0.7547
32	N	A	-1.7773
33	L	A	0.0000
34	E	A	-2.2981
35	S	A	0.0000
36	V	A	0.0000
37	T	A	0.0000
38	P	A	-0.7253
39	M	A	0.0000
40	T	A	-0.6862
41	L	A	0.0000
42	T	A	-0.5661
43	T	A	-1.1491
44	L	A	-0.8806
45	E	A	-2.0638
46	G	A	-2.3269
47	G	A	-1.8827
48	N	A	-1.3914
49	L	A	0.0000
50	E	A	-0.9682
51	A	A	-0.9265
52	K	A	-1.7250
53	V	A	0.0000
54	T	A	-1.6248
55	M	A	0.0000
56	L	A	0.0000
57	I	A	-1.8040
58	S	A	-1.6939
59	G	A	-1.7666
60	R	A	-2.5136
61	C	A	-1.6103
62	Q	A	-2.2312
63	E	A	-2.6613
64	V	A	-1.6227
65	K	A	-2.2297
66	A	A	-1.0832
67	V	A	-0.7582
68	L	A	0.0000
69	E	A	-1.8700
70	K	A	-2.1733
71	T	A	-2.2057
72	D	A	-2.7599
73	E	A	-2.6529
74	P	A	-1.6301
75	G	A	0.0000
76	K	A	-1.3055
77	Y	A	0.0000
78	T	A	-1.5075
79	A	A	-1.6555
80	D	A	-2.4421
81	G	A	-1.9972
82	G	A	-1.9991
83	K	A	-2.3530
84	H	A	-2.1755
85	V	A	-1.2712
86	A	A	-0.5903
87	Y	A	0.1285
88	I	A	0.0000
89	I	A	0.2560
90	R	A	-1.0610
91	S	A	0.0000
92	H	A	-1.9879
93	V	A	-1.8040
94	K	A	-3.0036
95	D	A	-3.0022
96	H	A	0.0000
97	Y	A	-0.8046
98	I	A	0.0000
99	F	A	0.0849
100	Y	A	0.0000
101	S	A	-1.1570
102	E	A	-2.1796
103	G	A	-2.2799
104	E	A	-2.5100
105	L	A	-0.9794
106	H	A	-1.5641
107	G	A	-1.8385
108	K	A	-2.4023
109	P	A	-2.0907
110	V	A	-1.6895
111	R	A	-1.7329
112	G	A	-0.8330
113	V	A	0.0000
114	K	A	-0.1898
115	L	A	0.0000
116	V	A	0.0000
117	G	A	0.0000
118	R	A	-3.0326
119	D	A	-3.4782
120	P	A	-2.8609
121	K	A	-3.1218
122	N	A	-2.3025
123	N	A	-1.7436
124	L	A	-0.2880
125	E	A	-2.1795
126	A	A	0.0000
127	L	A	-1.6485
128	E	A	-2.9013
129	D	A	-2.5455
130	F	A	0.0000
131	E	A	-3.2182
132	K	A	-3.1459
133	A	A	-1.8476
134	A	A	0.0000
135	G	A	-1.8829
136	A	A	-1.1585
137	R	A	-1.2624
138	G	A	-1.2634
139	L	A	0.0000
140	S	A	-1.1593
141	T	A	-0.7637
142	E	A	-1.0799
143	S	A	-0.4990
144	I	A	0.7990
145	L	A	1.1123
146	I	A	1.5524
147	P	A	0.0000
148	R	A	-1.8904
149	Q	A	-1.4413
150	S	A	-1.6397
151	E	A	-2.1362
152	T	A	-1.0375
153	C	A	-1.2579
154	S	A	-1.0956
155	P	A	-1.3864
156	G	A	-1.2840
157	S	A	-1.4116
158	D	A	-2.0620