Project name: Mb5-11_I18L_I104L_LVLLLL_Lib2_Lib3_overlap

Status: done

Started: 2026-07-06 07:00:27
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTLTVYAVTWYPRYGYGESGPLSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)
Show buried residues

Minimal score value
-2.7191
Maximal score value
1.4519
Average score
-0.7148
Total score value
-77.918

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4285
2 Q A -0.8177
3 A A -0.7523
4 N A -1.3516
5 S A -0.9818
6 G A -1.2605
7 S A -1.1825
8 L A 0.0000
9 E A -1.8445
10 V A -0.6374
11 V A 0.2806
12 E A -1.3675
13 A A -1.1977
14 S A -1.4679
15 P A -1.7234
16 T A -1.1395
17 S A -1.1782
18 L A 0.0000
19 Q A -1.0136
20 L A 0.0000
21 S A -1.0397
22 W A 0.0000
23 D A -1.9612
24 A A -1.3299
25 F A 0.0000
26 H A -1.0963
27 R A -0.2119
28 Y A 0.8833
29 H A 0.1696
30 N A -0.6185
31 G A 0.0933
32 F A 1.4519
33 T A 0.6830
34 H A 0.0381
35 P A -0.4184
36 V A -1.0554
37 R A -1.3300
38 Y A -0.8696
39 Y A 0.0000
40 R A -0.7892
41 V A 0.0000
42 T A 0.0000
43 Y A -0.3200
44 G A 0.0000
45 E A -1.5593
46 T A -1.2397
47 G A -1.2232
48 G A -1.3782
49 N A -1.5436
50 S A -0.9093
51 P A -0.3541
52 V A 0.4110
53 Q A -0.9674
54 E A -1.6606
55 F A -0.5755
56 T A -0.1449
57 V A -0.4296
58 P A -0.9740
59 G A -1.2617
60 S A -1.3019
61 K A -1.8292
62 S A -1.1861
63 T A -0.8571
64 A A 0.0000
65 T A -0.4190
66 L A 0.0000
67 S A -0.7959
68 G A -0.9858
69 L A 0.0000
70 K A -2.3691
71 P A -1.8620
72 G A -1.1352
73 V A -1.1276
74 D A -2.1606
75 Y A 0.0000
76 T A -0.8224
77 L A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.3126
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5845
85 Y A 0.0000
86 P A -0.4689
87 R A -1.1306
88 Y A 0.6489
89 G A 0.5592
90 Y A 0.8165
91 G A 0.1484
92 E A -0.8355
93 S A 0.0000
94 G A -0.7184
95 P A -0.4861
96 L A -0.4565
97 S A -0.5822
98 L A -0.7182
99 N A -1.8144
100 Y A -1.6832
101 R A -2.5167
102 T A 0.0000
103 E A -1.9914
104 L A -0.9923
105 D A -2.5676
106 K A -2.7191
107 P A -1.7900
108 S A -1.6388
109 Q A -1.6631
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018