Project name: A53T [mutate: AT53A]

Status: done

Started: 2024-06-30 13:02:22
Settings
Chain sequence(s) A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues AT53A
Energy difference between WT (input) and mutated protein (by FoldX) 0.878131 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:01:31)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:31)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:20)
Show buried residues

Minimal score value
-3.959
Maximal score value
3.1118
Average score
-0.9224
Total score value
-129.1316

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8612
2 D A 0.1300
3 V A 1.8630
4 F A 2.0393
5 M A 0.9362
6 K A -0.7654
7 G A -0.5641
8 L A -0.3217
9 S A -1.8636
10 K A -2.7826
11 A A -1.7057
12 K A -2.0154
13 E A -2.1919
14 G A -0.6913
15 V A 0.8991
16 V A 0.8291
17 A A -0.5653
18 A A -0.8578
19 A A -1.1184
20 E A -2.9552
21 K A -3.2030
22 T A -2.1196
23 K A -3.2930
24 Q A -3.1713
25 G A -1.8554
26 V A -0.2913
27 A A -1.4129
28 E A -2.5930
29 A A -1.4566
30 A A -1.5581
31 G A -2.6845
32 K A -3.2642
33 T A -2.3189
34 K A -2.9575
35 E A -2.1625
36 G A -0.7209
37 V A 1.3187
38 L A 1.5811
39 Y A 1.7626
40 V A 0.5381
41 G A -0.5295
42 S A -1.0973
43 K A -2.1547
44 T A -1.9132
45 K A -2.7164
46 E A -2.6474
47 G A -1.6343
48 V A -0.3040
49 V A 0.4059
50 H A -0.2904
51 G A 0.5959
52 V A 2.2486
53 T A 0.7127 mutated: AT53A
54 T A 0.3012
55 V A 0.7883
56 A A -0.8243
57 E A -2.9044
58 K A -3.3393
59 T A -2.3817
60 K A -3.6166
61 E A -3.9590
62 Q A -2.7442
63 V A -0.2719
64 T A -1.4383
65 N A -1.4139
66 V A 0.7830
67 G A 0.5883
68 G A 0.7525
69 A A 1.6568
70 V A 3.1118
71 V A 3.0507
72 T A 1.9770
73 G A 2.1610
74 V A 2.9698
75 T A 1.4707
76 A A 0.9250
77 V A 1.3363
78 A A 0.3328
79 Q A -1.1657
80 K A -1.5472
81 T A -0.6800
82 V A 0.0318
83 E A -1.7263
84 G A -0.9857
85 A A 0.0925
86 G A -0.1845
87 S A 0.3192
88 I A 1.4854
89 A A 0.9223
90 A A 1.2356
91 A A 1.2745
92 T A 1.0202
93 G A 0.9125
94 F A 1.8629
95 V A 1.1823
96 K A -1.7131
97 K A -2.7409
98 D A -3.0747
99 Q A -2.2090
100 L A -0.6707
101 G A -1.6529
102 K A -2.9237
103 N A -3.5657
104 E A -3.8963
105 E A -3.7178
106 G A -2.2185
107 A A -1.7389
108 P A -1.9036
109 Q A -2.6294
110 E A -2.6409
111 G A -1.0182
112 I A 1.0765
113 L A 0.2774
114 E A -1.7030
115 D A -1.5661
116 M A -0.0010
117 P A -0.3697
118 V A -0.4627
119 D A -2.3943
120 P A -2.4507
121 D A -3.0182
122 N A -2.6292
123 E A -2.7906
124 A A -1.3322
125 Y A -0.3122
126 E A -1.9844
127 M A -0.8126
128 P A -1.2836
129 S A -1.6616
130 E A -2.7938
131 E A -2.7542
132 G A -2.0398
133 Y A -0.6750
134 Q A -1.8112
135 D A -2.2074
136 Y A -1.0889
137 E A -2.3465
138 P A -1.8129
139 E A -2.0778
140 A A -1.1262
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018