Project name: PagP

Status: done

Started: 2026-06-17 10:31:13
Settings
Chain sequence(s) A: NADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLILASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:22)
Show buried residues

Minimal score value
-4.0731
Maximal score value
2.5383
Average score
-0.0833
Total score value
-13.4123

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A -2.0568
2 A A -1.4084
3 D A -2.4530
4 E A -2.5371
5 W A -0.7070
6 M A -0.9276
7 T A -1.7064
8 T A -1.3378
9 F A -1.1110
10 R A -2.5871
11 E A -2.6372
12 N A -1.7326
13 I A -1.1094
14 A A -1.6186
15 Q A -2.2998
16 T A 0.0000
17 W A -0.3347
18 Q A -1.7428
19 Q A -2.2572
20 P A -1.5797
21 E A -1.8602
22 H A -0.2677
23 Y A 1.7170
24 D A 0.0000
25 L A 2.3438
26 Y A 0.0000
27 I A 1.6107
28 P A 0.0000
29 A A 0.4629
30 I A 0.5606
31 T A 0.2017
32 W A 0.4052
33 H A 0.0000
34 A A 0.0000
35 R A -0.5420
36 F A 1.1943
37 A A 0.0000
38 Y A 0.0000
39 D A -2.3609
40 K A -3.8699
41 E A -4.0731
42 K A -3.4818
43 T A 0.0000
44 D A -4.0196
45 R A -3.3462
46 Y A -1.8241
47 N A -1.2694
48 E A -1.1289
49 R A -1.5398
50 P A 0.0000
51 W A 0.6510
52 G A 0.3108
53 G A 0.7139
54 G A 1.0727
55 F A 2.3141
56 G A 0.0000
57 L A 0.7926
58 S A 0.0000
59 R A 0.0000
60 W A -1.0439
61 D A -1.9510
62 E A -2.7373
63 K A -2.6164
64 G A -1.5670
65 N A -0.6567
66 W A 0.0000
67 H A 0.0000
68 G A 0.0000
69 L A 1.0266
70 Y A 0.9895
71 A A 0.8498
72 M A 0.0000
73 A A 0.4820
74 F A 0.0000
75 K A -0.4316
76 D A 0.0000
77 S A -0.4649
78 W A -0.0800
79 N A -0.9254
80 K A -1.0174
81 W A 0.2822
82 E A -0.1796
83 P A 0.0988
84 I A 0.4615
85 A A 0.6023
86 G A 0.5413
87 Y A 0.0000
88 G A 0.0000
89 W A 0.8646
90 E A 0.0000
91 S A 0.4704
92 T A 0.4545
93 W A 0.5551
94 R A -0.6410
95 P A -0.0671
96 L A 0.5679
97 A A -0.2656
98 D A -1.2075
99 E A -2.0722
100 N A -1.1975
101 F A 0.2483
102 H A 0.0000
103 L A 1.5850
104 G A 0.0000
105 L A 2.2256
106 G A 1.3843
107 F A 1.8393
108 T A 0.0000
109 A A 1.1571
110 G A 0.8360
111 V A 1.3001
112 T A 0.7611
113 A A 0.6202
114 R A -0.2027
115 D A -0.9539
116 N A -0.8537
117 W A 0.3002
118 N A -0.5444
119 Y A 0.7896
120 I A 1.9272
121 P A 1.1326
122 L A 1.0668
123 P A 0.8331
124 V A 1.4508
125 L A 2.2769
126 L A 2.0008
127 I A 2.5383
128 L A 0.0000
129 A A 1.5449
130 S A 1.3415
131 V A 2.2318
132 G A 0.0000
133 Y A 1.2483
134 G A 0.0756
135 P A 0.8881
136 V A 1.9466
137 T A 0.0000
138 F A 1.9133
139 Q A 0.0000
140 M A 1.1545
141 T A 0.0000
142 Y A 1.1993
143 I A 1.0048
144 P A 0.0883
145 G A -0.5380
146 T A -0.2125
147 Y A 0.6656
148 N A -0.7088
149 N A -1.0991
150 G A -0.4539
151 N A 0.1098
152 V A 0.3047
153 Y A 1.0573
154 F A 0.0000
155 A A 0.0000
156 W A 0.0000
157 M A 1.3730
158 R A 0.0000
159 F A 2.1636
160 Q A 1.6059
161 F A 2.2166
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018