Project name: 59f5ead1f46d016

Chain sequence(s)	A: FVNQHLCGSHLVEALYLVCGERGFFYTKPAAKGIVEQCCTSICSLYQLENYCN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:43)

• Minimal score value: -2.5101
• Maximal score value: 2.7869
• Average score: -0.1002
• Total score value: -5.3103

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	F	A	2.7869
2	V	A	2.0949
3	N	A	0.1954
4	Q	A	-0.1984
5	H	A	-0.3192
6	L	A	-0.1615
7	C	A	0.0468
8	G	A	-0.3816
9	S	A	-0.6967
10	H	A	-1.0878
11	L	A	0.0000
12	V	A	0.4837
13	E	A	-0.9130
14	A	A	0.4883
15	L	A	0.0000
16	Y	A	0.6758
17	L	A	1.6297
18	V	A	1.1707
19	C	A	0.0000
20	G	A	-1.0026
21	E	A	-2.4358
22	R	A	-2.5101
23	G	A	-0.7633
24	F	A	0.4989
25	F	A	1.6591
26	Y	A	1.0857
27	T	A	-0.4855
28	K	A	-1.7109
29	P	A	-1.3080
30	A	A	-1.0006
31	A	A	-1.0326
32	K	A	-1.4793
33	G	A	-1.1098
34	I	A	0.0000
35	V	A	0.1234
36	E	A	-0.7837
37	Q	A	-0.4490
38	C	A	0.0000
39	C	A	0.1988
40	T	A	0.1584
41	S	A	0.3254
42	I	A	1.2088
43	C	A	0.0000
44	S	A	1.0442
45	L	A	1.5524
46	Y	A	1.0499
47	Q	A	-0.1259
48	L	A	0.0000
49	E	A	-0.8866
50	N	A	-1.1733
51	Y	A	-0.0937
52	C	A	0.0000
53	N	A	-1.6786