Project name: 15mer

Status: done

Started: 2026-05-30 05:50:10
Settings
Chain sequence(s) I: MENVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSSTSPKLWIYDTSKLASGVPGRFSGSGSGNSYSLTISSMEAEDVATYYCFQGSGYPLTFGAGTKLELKGGGGSGGGGSGGGGSEVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARKKSYAMDYWGQGTSVTVS
input PDB
Selected Chain(s) I
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with I chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:12)
Show buried residues

Minimal score value
-3.2865
Maximal score value
1.2889
Average score
-0.5983
Total score value
-142.3879

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M I 0.3947
2 E I -0.8468
3 N I 0.0913
4 V I 1.2638
5 L I 0.0000
6 T I 0.2489
7 Q I 0.0000
8 S I 0.0190
9 P I 0.3169
10 A I 0.6612
11 I I 1.2889
12 M I 0.4197
13 S I -0.5957
14 A I 0.0000
15 S I -1.9596
16 P I -1.8680
17 G I -1.9070
18 E I -2.5383
19 K I -2.5490
20 V I -1.0122
21 T I -0.3749
22 M I 0.0000
23 T I -0.2420
24 C I 0.0000
25 S I -0.3420
26 A I 0.0000
27 S I -0.1208
28 S I -0.4242
29 S I -0.6337
30 V I -0.2163
31 S I -0.1662
32 Y I 0.5840
33 M I 0.0000
34 H I 0.0000
35 W I 0.0000
36 Y I 0.0000
37 Q I 0.0000
38 Q I 0.0000
39 K I -1.2744
40 S I -0.6980
41 S I -0.6724
42 T I -0.8126
43 S I -0.5988
44 P I 0.0000
45 K I -0.4974
46 L I 0.0000
47 W I 0.0000
48 I I 0.0000
49 Y I 0.0753
50 D I -0.4315
51 T I -0.5611
52 S I -0.9664
53 K I -1.4054
54 L I -0.4107
55 A I 0.0000
56 S I -0.5680
57 G I -0.9410
58 V I 0.0000
59 P I -0.7105
60 G I -0.6314
61 R I -0.7853
62 F I 0.0000
63 S I -0.5777
64 G I 0.0000
65 S I -0.7767
66 G I -0.7458
67 S I -0.6899
68 G I -0.7337
69 N I -1.2623
70 S I -0.9227
71 Y I 0.0000
72 S I -0.3440
73 L I 0.0000
74 T I -0.4905
75 I I 0.0000
76 S I -1.5006
77 S I -1.4798
78 M I 0.0000
79 E I -1.9687
80 A I -1.8647
81 E I -2.2809
82 D I 0.0000
83 V I -0.9850
84 A I 0.0000
85 T I -0.4207
86 Y I 0.0000
87 Y I 0.0000
88 C I 0.0000
89 F I 0.0000
90 Q I 0.0000
91 G I 0.0000
92 S I 0.3772
93 G I 0.0855
94 Y I 0.4129
95 P I -0.3908
96 L I 0.0000
97 T I 0.0665
98 F I 0.0000
99 G I 0.0000
100 A I -0.0989
101 G I 0.0000
102 T I 0.0000
103 K I -0.3475
104 L I 0.0000
105 E I -1.6644
106 L I 0.0000
107 K I -2.3190
108 G I -1.9614
109 G I 0.0000
110 G I -1.5298
111 G I -1.1336
112 S I -1.1738
113 G I -1.6173
114 G I -1.3593
115 G I -1.3869
116 G I -1.3215
117 S I -1.1385
118 G I -1.3664
119 G I -1.4878
120 G I -1.3666
121 G I -1.2139
122 S I -1.5062
123 E I -2.0651
124 V I -0.9657
125 Q I -1.4019
126 L I 0.0000
127 Q I -1.7521
128 Q I -1.2605
129 S I -1.2238
130 G I -0.8356
131 A I -0.2799
132 E I -0.4391
133 L I 0.6971
134 V I -0.3376
135 R I -1.7014
136 A I -1.4044
137 G I -1.3184
138 S I -1.2201
139 S I -1.6188
140 V I 0.0000
141 K I -2.1154
142 M I 0.0000
143 S I -0.9257
144 C I 0.0000
145 K I -1.7310
146 A I 0.0000
147 S I -1.1175
148 G I -0.9958
149 Y I -0.3740
150 T I -0.1001
151 F I 0.0000
152 T I -1.0169
153 S I -0.7856
154 Y I -0.7747
155 G I 0.0000
156 I I 0.0000
157 N I 0.0000
158 W I 0.0000
159 V I 0.0000
160 K I 0.0000
161 Q I -0.6166
162 R I -1.1784
163 P I -0.8464
164 G I -1.2145
165 Q I -1.1364
166 G I -0.8477
167 L I 0.0000
168 E I -0.6784
169 W I 0.0000
170 I I 0.0000
171 G I 0.0000
172 Y I 0.0334
173 I I 0.0000
174 N I -0.8865
175 P I 0.0000
176 G I -1.3166
177 N I -1.4621
178 G I -0.9933
179 Y I -0.0742
180 T I -0.1517
181 K I -0.5624
182 Y I -1.2236
183 N I 0.0000
184 E I -3.2865
185 K I -3.1742
186 F I 0.0000
187 K I -3.2242
188 G I -2.1813
189 K I -2.1662
190 T I 0.0000
191 T I -1.0404
192 L I 0.0000
193 T I 0.0063
194 V I -0.7713
195 D I -1.5638
196 K I -2.1745
197 S I -1.2479
198 S I -1.1294
199 S I -1.2558
200 T I 0.0000
201 A I 0.0000
202 Y I -0.4804
203 M I 0.0000
204 Q I -1.5205
205 L I 0.0000
206 R I -2.1674
207 S I -1.4153
208 L I 0.0000
209 T I -1.3754
210 S I -1.4503
211 E I -2.0507
212 D I 0.0000
213 S I -0.6829
214 A I 0.0000
215 V I 0.0779
216 Y I 0.0000
217 F I 0.0000
218 C I 0.0000
219 A I 0.0000
220 R I 0.0000
221 K I 0.0000
222 K I -1.6112
223 S I -0.4825
224 Y I 0.5629
225 A I 0.0000
226 M I 0.0000
227 D I -0.2549
228 Y I 0.1536
229 W I -0.2431
230 G I 0.0000
231 Q I -1.3556
232 G I -0.7468
233 T I 0.0000
234 S I -0.1879
235 V I 0.0000
236 T I -0.2539
237 V I 0.0000
238 S I -0.5918
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018