Project name: 5ae6ff6da276f04

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFAFSSYMGWFRQAPGKGRELVAAWFDGTKYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCDRGIGARRGPYYMDVWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:03)

• Minimal score value: -2.7988
• Maximal score value: 2.1961
• Average score: -0.7039
• Total score value: -83.7612

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.0586
2	V	A	-1.0989
3	Q	A	-1.1577
4	L	A	0.0000
5	V	A	1.2246
6	E	A	0.0000
7	S	A	-0.5406
8	G	A	-1.1723
9	G	A	-0.8292
10	G	A	-0.1160
11	L	A	0.9267
12	V	A	0.0000
13	Q	A	-1.4302
14	P	A	-1.6610
15	G	A	-1.4342
16	G	A	-1.0156
17	S	A	-1.3579
18	L	A	-1.1274
19	R	A	-2.2563
20	L	A	0.0000
21	S	A	-0.3786
22	C	A	0.0000
23	A	A	-0.1018
24	A	A	0.0000
25	S	A	-0.9121
26	G	A	-1.1014
27	F	A	-0.4342
28	A	A	-0.1307
29	F	A	-0.7337
30	S	A	-0.7776
31	S	A	-0.2878
32	Y	A	0.0000
33	M	A	0.0000
34	G	A	0.0000
35	W	A	0.0000
36	F	A	0.0176
37	R	A	0.0000
38	Q	A	-1.5296
39	A	A	-1.6235
40	P	A	-1.1710
41	G	A	-1.6321
42	K	A	-2.5642
43	G	A	-2.1623
44	R	A	-1.9602
45	E	A	-1.1565
46	L	A	0.1305
47	V	A	0.0000
48	A	A	0.0000
49	A	A	0.0000
50	W	A	-0.4959
51	F	A	-1.1169
52	D	A	-2.2312
53	G	A	-1.4957
54	T	A	-0.9725
55	K	A	-0.7961
56	Y	A	-0.0689
57	Y	A	-0.7198
58	P	A	-1.2494
59	D	A	-2.5331
60	S	A	-1.5759
61	V	A	0.0000
62	E	A	-2.6648
63	G	A	-1.7885
64	R	A	-1.5339
65	F	A	0.0000
66	T	A	-0.9758
67	I	A	0.0000
68	S	A	-0.5860
69	R	A	-1.1479
70	D	A	-1.8152
71	N	A	-2.3566
72	A	A	-1.7670
73	K	A	-2.6240
74	R	A	-2.2864
75	M	A	-1.1309
76	V	A	0.0000
77	Y	A	-0.5959
78	L	A	0.0000
79	Q	A	-1.5277
80	M	A	0.0000
81	N	A	-1.4583
82	S	A	-1.2409
83	L	A	0.0000
84	R	A	-2.3100
85	A	A	-1.7446
86	E	A	-2.2233
87	D	A	0.0000
88	T	A	-0.8723
89	A	A	0.0000
90	V	A	-0.4311
91	Y	A	0.0000
92	Y	A	-0.0775
93	C	A	0.0000
94	D	A	0.0000
95	R	A	0.2097
96	G	A	0.0000
97	I	A	1.9281
98	G	A	0.4646
99	A	A	-0.9327
100	R	A	-2.7988
101	R	A	-2.7356
102	G	A	-1.2680
103	P	A	0.1172
104	Y	A	1.4835
105	Y	A	2.1961
106	M	A	1.2793
107	D	A	0.5388
108	V	A	0.3268
109	W	A	0.1571
110	G	A	-0.0706
111	Q	A	-0.8361
112	G	A	-0.4486
113	T	A	-0.6656
114	Q	A	-0.9900
115	V	A	0.0000
116	T	A	-0.3412
117	V	A	0.0000
118	S	A	-0.8094
119	S	A	-0.5380