Project name: 5ae96eeb7187ce5

Status: done

Started: 2026-06-15 06:32:50
Settings
Chain sequence(s) A: YDNREIVMKYIHYKLSQRGYEWDASEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:18)
Show buried residues

Minimal score value
-3.8811
Maximal score value
1.3412
Average score
-1.1288
Total score value
-156.9075

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 Y A -0.1813
8 D A -1.7773
9 N A 0.0000
10 R A -1.8917
11 E A -1.8942
12 I A 0.0000
13 V A 0.0000
14 M A -1.0325
15 K A -1.2519
16 Y A 0.0000
17 I A 0.0000
18 H A -1.0033
19 Y A -0.5889
20 K A -1.0588
21 L A 0.0000
22 S A -1.7885
23 Q A -2.3361
24 R A -2.7865
25 G A -2.0528
26 Y A -1.7467
27 E A -2.6224
28 W A 0.0000
29 D A -2.4227
30 A A -1.6342
87 S A -0.9465
88 E A -1.3339
89 V A -0.0759
90 V A 0.0000
91 H A -0.4045
92 L A 0.4291
93 T A 0.0000
94 L A 0.0000
95 R A -1.0782
96 Q A -1.6692
97 A A 0.0000
98 G A 0.0000
99 D A -2.8385
100 D A 0.0000
101 F A -1.8957
102 S A 0.0000
103 R A -3.7351
104 R A -3.2324
105 Y A -2.1724
106 R A -3.8403
107 R A -3.8811
108 D A -3.3783
109 F A -2.2080
110 A A -2.2288
111 E A -2.6251
112 M A -1.6604
113 S A -1.2120
114 S A -1.1619
115 Q A -1.6278
116 L A 0.0000
117 H A -1.4984
118 L A 0.0000
119 T A -0.2959
120 P A 0.2146
121 F A 1.3412
122 T A -0.1643
123 A A 0.0000
124 R A -2.0260
125 G A -1.2646
126 R A -1.1696
127 F A 0.0000
128 A A -1.3196
129 T A -1.4014
130 V A -1.1794
131 V A 0.0000
132 E A -2.9721
133 E A -3.1901
134 L A -1.9920
135 F A 0.0000
136 R A -3.6731
137 D A -3.2315
138 G A -1.9129
139 V A -1.0928
140 N A -1.2920
141 W A -0.4644
142 G A -0.8728
143 R A -0.9308
144 I A 0.0000
145 V A 0.0000
146 A A -0.3074
147 F A 0.0000
148 F A 0.0000
149 E A 0.0000
150 F A 0.0000
151 G A 0.0000
152 G A 0.0000
153 V A 0.0000
154 M A 0.0000
155 C A 0.0000
156 V A -0.7437
157 E A -1.1909
158 S A 0.0000
159 V A -1.4541
160 N A -2.3544
161 R A -2.3697
162 E A -2.5162
163 M A -1.3045
164 S A -1.2528
165 P A -1.1273
166 L A 0.0000
167 V A 0.0000
168 D A -2.2147
169 N A -1.7161
170 I A 0.0000
171 A A 0.0000
172 L A -0.1736
173 W A -0.7415
174 M A 0.0000
175 T A -1.5570
176 E A -2.3417
177 Y A -1.6472
178 L A 0.0000
179 N A -2.6702
180 R A -3.1073
181 H A -2.2807
182 L A 0.0000
183 H A -1.9987
184 T A -1.7364
185 W A -1.3636
186 I A 0.0000
187 Q A -2.5394
188 D A -2.8111
189 N A -2.4096
190 G A -2.1520
191 G A -1.6733
192 W A 0.0000
193 D A -1.9901
194 A A -1.4514
195 F A 0.0000
196 V A 0.0000
197 E A -1.6150
198 L A 0.4244
199 Y A 0.0961
200 G A -0.5734
201 P A -0.8084
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018