Project name: query_structure

Status: done

Started: 2026-03-16 23:24:33
Settings
Chain sequence(s) A: GIPCGESCVWIPCLTSAIGCSCKSKVCYRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:14)
Show buried residues

Minimal score value
-2.0529
Maximal score value
2.0963
Average score
0.2011
Total score value
6.0334

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.7108
2 I A 0.9724
3 P A 0.1465
4 C A 0.4978
5 G A -0.1420
6 E A 0.0434
7 S A 0.3883
8 C A 0.9666
9 V A 2.0963
10 W A 2.0910
11 I A 1.6194
12 P A 1.0161
13 C A 0.0000
14 L A 1.6885
15 T A 1.1244
16 S A 0.7930
17 A A 1.2037
18 I A 1.9098
19 G A 0.1996
20 C A 0.0000
21 S A -0.7100
22 C A -0.4476
23 K A -1.9150
24 S A -1.1950
25 K A -1.0408
26 V A -0.5297
27 C A 0.0000
28 Y A -0.7531
29 R A -1.2265
30 D A -2.0529
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018