Project name: cluster0

Chain sequence(s)	A: VFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:35)

• Minimal score value: -3.876
• Maximal score value: 2.7799
• Average score: -0.8529
• Total score value: -42.6465

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
220	V	A	2.6960
221	F	A	2.7799
222	I	A	1.2315
223	P	A	-0.1555
224	K	A	-1.5212
225	P	A	-1.2280
226	F	A	-0.8196
227	R	A	-1.6881
228	A	A	-0.3767
229	F	A	0.1773
230	A	A	0.0000
231	F	A	1.0949
232	V	A	0.0000
233	T	A	1.5479
234	F	A	0.9323
235	A	A	-0.3861
236	D	A	-1.6142
237	D	A	-2.7228
238	Q	A	-2.1265
239	I	A	-0.5954
240	A	A	0.0000
241	Q	A	-2.2209
242	S	A	-1.3774
243	L	A	-0.8612
244	C	A	-1.3141
245	G	A	-1.7341
246	E	A	-2.8427
247	D	A	-2.3162
248	L	A	0.2373
249	I	A	1.8502
250	I	A	1.0547
251	K	A	-0.6961
252	G	A	0.1553
253	I	A	1.6086
254	S	A	0.9271
255	V	A	0.2280
256	H	A	-0.7434
257	I	A	-0.1386
258	S	A	-0.7739
259	N	A	-1.2828
260	A	A	-1.4855
261	E	A	-2.3777
262	P	A	-2.3058
263	K	A	-3.3506
264	H	A	-3.5310
265	N	A	-3.3718
266	S	A	-2.9958
267	N	A	-3.7146
268	R	A	-3.8760
269	Q	A	-2.6232