Project name: 123

Chain sequence(s)	A: QVQLLESGGGLVQPGGSLRLSCAASGGTFTNYKMGWFRQAPGKGREFVAAITWSGSSTDYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCVAKYWRNEGYLSDYPYWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:05)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:05)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:05)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:05)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:05)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:52)

• Minimal score value: -3.0465
• Maximal score value: 0.9541
• Average score: -0.8421
• Total score value: -103.5832

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
261	Q	A	-1.6591
262	V	A	0.0000
263	Q	A	-1.1925
264	L	A	0.0000
265	L	A	0.5781
266	E	A	-0.1800
267	S	A	-0.7994
268	G	A	-1.2533
269	G	A	-0.8650
270	G	A	-0.0831
271	L	A	0.9541
272	V	A	0.0000
273	Q	A	-1.4856
274	P	A	-1.7991
275	G	A	-1.5367
276	G	A	-1.0619
277	S	A	-1.4274
278	L	A	-1.1505
279	R	A	-2.2826
280	L	A	0.0000
281	S	A	-0.6057
282	C	A	0.0000
283	A	A	-0.2651
284	A	A	0.0000
285	S	A	-0.9143
286	G	A	-1.4130
287	G	A	-1.2367
288	T	A	-0.7496
289	F	A	0.0000
290	T	A	-0.3236
291	N	A	-0.5925
292	Y	A	0.0000
293	K	A	-0.5558
294	M	A	0.0000
295	G	A	0.0000
296	W	A	0.0000
297	F	A	0.0000
298	R	A	0.0000
299	Q	A	-2.0378
300	A	A	-1.8826
301	P	A	-1.2743
302	G	A	-1.7606
303	K	A	-2.9183
304	G	A	-2.7206
305	R	A	-3.0465
306	E	A	-2.2619
307	F	A	-0.8103
308	V	A	0.0000
309	A	A	0.0000
310	A	A	0.0000
311	I	A	0.0000
312	T	A	-0.3563
313	W	A	-0.0098
314	S	A	-0.2507
315	G	A	-0.4718
316	S	A	-0.3669
317	S	A	-0.5311
318	T	A	-0.6228
319	D	A	-1.1519
320	Y	A	-1.2290
321	A	A	-1.5422
322	D	A	-2.5771
323	S	A	-1.7744
324	V	A	0.0000
325	K	A	-2.7607
326	G	A	-1.7737
327	R	A	-1.5995
328	F	A	0.0000
329	T	A	-1.0548
330	I	A	0.0000
331	S	A	-0.4744
332	R	A	-0.8207
333	D	A	-1.3746
334	N	A	-1.3734
335	A	A	-1.2712
336	K	A	-2.1964
337	N	A	-1.6856
338	T	A	-0.9730
339	L	A	0.0000
340	Y	A	-0.6562
341	L	A	0.0000
342	Q	A	-1.5655
343	M	A	0.0000
344	N	A	-1.5788
345	S	A	-1.3482
346	L	A	0.0000
347	R	A	-2.7834
348	A	A	-1.9635
349	E	A	-2.4015
350	D	A	0.0000
351	T	A	-0.9425
352	A	A	0.0000
353	V	A	-0.4999
354	Y	A	0.0000
355	Y	A	-0.2541
356	C	A	0.0000
357	V	A	0.0000
358	A	A	0.0000
359	K	A	0.0000
360	Y	A	-0.8253
361	W	A	-1.2766
362	R	A	-2.7430
363	N	A	-2.7736
364	E	A	-2.8358
365	G	A	-1.5563
366	Y	A	0.1601
367	L	A	-0.1960
368	S	A	-0.5245
369	D	A	-1.8325
370	Y	A	0.0000
371	P	A	-0.4376
372	Y	A	-0.1507
373	W	A	0.0773
374	G	A	-0.2722
375	Q	A	-1.1086
376	G	A	-0.6384
377	T	A	-0.7857
378	Q	A	-1.1057
379	V	A	0.0000
380	T	A	-0.3757
381	V	A	0.0000
382	S	A	-0.7812
383	S	A	-0.7524