Project name: 5b76bddafe600

Status: done

Started: 2026-05-19 18:35:26
Settings
Chain sequence(s) A: NFMLTQPHSVSESPGKTLTISCTGSSASIASHYVQWYQQRPGGAPTTLIYENDQRPSEVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDGNNHWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:47)
Show buried residues

Minimal score value
-3.2329
Maximal score value
1.8507
Average score
-0.8532
Total score value
-184.2807

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A -1.2556
2 F A 0.0000
3 M A 0.9313
4 L A 0.0000
5 T A 0.0221
6 Q A -0.4919
7 P A -0.8093
8 H A -1.3261
9 S A -0.9413
10 V A -0.4558
11 S A -0.7011
12 E A -0.9600
13 S A -1.1125
14 P A -1.6249
15 G A -1.8193
16 K A -2.3407
17 T A -1.2627
18 L A 0.0000
19 T A -0.1364
20 I A 0.0000
21 S A -0.2457
22 C A 0.0000
23 T A -0.3132
24 G A -0.1573
25 S A -0.2408
26 S A -0.5668
27 A A -0.5316
28 S A -0.5421
29 I A 0.0000
30 A A -0.1793
31 S A -0.2281
32 H A -0.2661
33 Y A 0.5303
34 V A 0.0000
35 Q A 0.0000
36 W A 0.0000
37 Y A -0.0606
38 Q A -0.8371
39 Q A -1.5823
40 R A -2.4557
41 P A -1.5663
42 G A -1.2491
43 G A -1.1574
44 A A -0.7178
45 P A -0.8563
46 T A -0.4199
47 T A -0.1809
48 L A 0.0000
49 I A 0.0000
50 Y A -0.5482
51 E A -1.1350
52 N A -1.2902
53 D A -2.4394
54 Q A -2.1682
55 R A -2.0191
56 P A -1.3907
57 S A -1.5463
58 E A -2.1810
59 V A -1.4770
60 P A -1.6671
61 D A -2.3829
62 R A -1.3703
63 F A 0.0000
64 S A -1.4021
65 G A -1.2025
66 S A -1.0921
67 I A -0.5364
68 D A -1.2657
69 S A -0.9656
70 S A -0.7920
71 S A -0.7883
72 N A -0.8505
73 S A 0.0000
74 A A 0.0000
75 S A -0.5197
76 L A 0.0000
77 T A -0.2404
78 I A 0.0000
79 S A -1.3722
80 G A -1.6129
81 L A 0.0000
82 K A -2.3160
83 T A -1.8742
84 E A -2.7493
85 D A 0.0000
86 E A -2.4873
87 A A 0.0000
88 D A -1.6631
89 Y A 0.0000
90 Y A 0.2306
91 C A 0.0000
92 Q A 0.0000
93 S A 0.0000
94 Y A -0.2328
95 D A -1.3727
96 G A -1.9709
97 N A -2.3547
98 N A -2.3213
99 H A -1.6149
100 W A 0.5214
101 V A 0.0000
102 F A 1.8507
103 G A 0.6451
104 G A -0.3677
105 G A -0.5491
106 T A 0.0000
107 K A -1.2714
108 L A 0.0000
109 T A 0.0000
110 V A 0.0000
111 L A -0.6046
112 S A -0.5801
113 Q A -1.0187
114 P A -1.2051
115 K A -1.9996
116 A A -1.1722
117 A A -0.8248
118 P A 0.0000
119 S A -0.2697
120 V A 0.0000
121 T A 0.1564
122 L A 0.5238
123 F A 1.2820
124 P A 0.4701
125 P A 0.0000
126 S A -1.1152
127 S A -1.7870
128 E A -2.7715
129 E A -2.3410
130 L A -2.0851
131 Q A -2.5240
132 A A -2.1371
133 N A -2.8556
134 K A -3.0053
135 A A 0.0000
136 T A -0.1024
137 L A 0.0000
138 V A 1.2035
139 C A 0.0000
140 L A 1.0473
141 I A 0.0000
142 S A -0.7042
143 D A -1.8812
144 F A 0.0000
145 Y A 0.0000
146 P A 0.0000
147 G A -0.7852
148 A A -0.5254
149 V A -0.2357
150 T A -0.2059
151 V A -0.0684
152 A A -0.5379
153 W A 0.0000
154 K A -1.2693
155 A A 0.0000
156 D A -1.6948
157 S A -1.0947
158 S A -0.7118
159 P A -0.8914
160 V A -0.7858
161 K A -1.7633
162 A A -0.9715
163 G A -0.8801
164 V A -0.7884
165 E A -1.4524
166 T A -0.4912
167 T A -0.4371
168 T A -0.2961
169 P A -0.5741
170 S A -1.3078
171 K A -2.7040
172 Q A -2.1845
173 S A -1.6474
174 N A -2.2750
175 N A -2.6808
176 K A -2.4283
177 Y A -1.6925
178 A A -0.9303
179 A A 0.0000
180 S A 0.2526
181 S A 0.0000
182 Y A 0.5472
183 L A 0.0000
184 S A -0.4913
185 L A -0.8996
186 T A -1.8017
187 P A -2.4957
188 E A -3.2329
189 Q A -2.5909
190 W A 0.0000
191 K A -3.1530
192 S A -2.5169
193 H A -2.5213
194 K A -2.5811
195 S A -1.5604
196 Y A 0.0000
197 S A -1.1162
198 C A 0.0000
199 Q A -1.2231
200 V A 0.0000
201 T A -0.7241
202 H A 0.0000
203 E A -2.0185
204 G A -1.4025
205 S A -0.7691
206 T A -0.7383
207 V A -0.7680
208 E A -2.1984
209 K A -1.5813
210 T A -0.8780
211 V A -0.0885
212 A A -0.9703
213 P A -1.2242
214 T A -0.9683
215 E A -1.5071
216 C A -0.1857
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018