Project name: query_structure

Status: done

Started: 2026-03-17 00:59:17
Settings
Chain sequence(s) A: RNGIPCGESCVYLPCFTAPLGCSCSSKVCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:10)
Show buried residues

Minimal score value
-2.4308
Maximal score value
2.0749
Average score
0.3701
Total score value
11.1025

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 R A -2.4308
2 N A -1.9443
3 G A -0.7490
4 I A 1.0340
5 P A 0.2816
6 C A 0.8225
7 G A 0.1190
8 E A 0.2260
9 S A 0.5791
10 C A 1.0193
11 V A 1.2651
12 Y A 1.7760
13 L A 1.6482
14 P A 1.1022
15 C A 0.0000
16 F A 2.0749
17 T A 1.3222
18 A A 0.9432
19 P A 0.7739
20 L A 1.5423
21 G A 0.4086
22 C A 0.7881
23 S A 0.2034
24 C A 0.4389
25 S A -0.5211
26 S A -0.8082
27 K A -0.6937
28 V A 0.1933
29 C A 0.0000
30 G A -0.3122
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018