Project name: 5c73544759724d

Chain sequence(s)	A: MQVQLVESGGGSVQAGGSLRLSCTASGTKELKYAAFDLGWFRQAPGQEREAVAAIDRDGGITYYADSVKGRFTISRDNAKNTVTLQMNNLKPVDTAIYYCAARRSRNRTYESWGQGTQVTVSGGGGSHHHHHHLEVSGWRLFKKIS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:02)

• Minimal score value: -3.3429
• Maximal score value: 1.3525
• Average score: -0.9433
• Total score value: -137.7276

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.0763
2	Q	A	-1.3120
3	V	A	0.0000
4	Q	A	-1.3192
5	L	A	0.0000
6	V	A	0.6657
7	E	A	0.0000
8	S	A	-0.6077
9	G	A	-1.2681
10	G	A	-1.1375
11	G	A	-0.9102
12	S	A	-0.7460
13	V	A	-0.9697
14	Q	A	-2.1271
15	A	A	-1.9277
16	G	A	-2.0285
17	G	A	-1.5003
18	S	A	-1.5229
19	L	A	-1.2288
20	R	A	-2.1414
21	L	A	0.0000
22	S	A	-0.5689
23	C	A	0.0000
24	T	A	-0.3157
25	A	A	0.0000
26	S	A	-0.9456
27	G	A	-1.7395
28	T	A	-1.9426
29	K	A	-2.9215
30	E	A	-2.9987
31	L	A	-2.1783
32	K	A	-2.6347
33	Y	A	0.0000
34	A	A	-1.7674
35	A	A	-1.6891
36	F	A	-1.6592
37	D	A	0.0000
38	L	A	0.0000
39	G	A	0.0000
40	W	A	0.0000
41	F	A	-0.2437
42	R	A	0.0000
43	Q	A	-1.7791
44	A	A	-1.1599
45	P	A	-1.1626
46	G	A	-1.6794
47	Q	A	-2.8326
48	E	A	-3.3429
49	R	A	-2.6381
50	E	A	-2.3087
51	A	A	-0.5339
52	V	A	0.0000
53	A	A	0.0000
54	A	A	0.5716
55	I	A	0.0000
56	D	A	-0.9571
57	R	A	-2.4104
58	D	A	-2.4477
59	G	A	-1.3757
60	G	A	-0.4771
61	I	A	1.3525
62	T	A	1.2693
63	Y	A	1.1711
64	Y	A	-0.3306
65	A	A	-1.1945
66	D	A	-2.3118
67	S	A	-1.3157
68	V	A	0.0000
69	K	A	-2.4617
70	G	A	-1.8829
71	R	A	-1.6346
72	F	A	0.0000
73	T	A	-0.7131
74	I	A	0.0000
75	S	A	-0.5817
76	R	A	-1.4528
77	D	A	-1.7063
78	N	A	-2.1160
79	A	A	-1.4331
80	K	A	-2.1528
81	N	A	-1.6474
82	T	A	-0.9580
83	V	A	0.0000
84	T	A	-0.7603
85	L	A	0.0000
86	Q	A	-1.1641
87	M	A	0.0000
88	N	A	-1.9397
89	N	A	-2.3797
90	L	A	0.0000
91	K	A	-1.7389
92	P	A	-0.4135
93	V	A	1.1668
94	D	A	0.0000
95	T	A	0.0475
96	A	A	0.0000
97	I	A	-0.2172
98	Y	A	0.0000
99	Y	A	-0.0797
100	C	A	0.0000
101	A	A	0.0000
102	A	A	0.0000
103	R	A	-2.1906
104	R	A	-2.6224
105	S	A	-2.2576
106	R	A	-2.8712
107	N	A	-2.8044
108	R	A	-2.8392
109	T	A	-1.8270
110	Y	A	-1.1879
111	E	A	-2.0190
112	S	A	0.0000
113	W	A	-0.2659
114	G	A	-0.2156
115	Q	A	-0.8577
116	G	A	0.0000
117	T	A	-0.6571
118	Q	A	-1.1728
119	V	A	0.0000
120	T	A	-0.5887
121	V	A	0.0000
122	S	A	-1.2046
123	G	A	-1.4586
124	G	A	-1.7657
125	G	A	-1.5341
126	G	A	-1.4439
127	S	A	-1.5858
128	H	A	-2.2473
129	H	A	-2.5258
130	H	A	-2.7395
131	H	A	-2.4761
132	H	A	-2.1926
133	H	A	-1.4795
134	L	A	0.2755
135	E	A	-0.8250
136	V	A	1.1689
137	S	A	0.1626
138	G	A	-0.0765
139	W	A	1.0232
140	R	A	-0.3662
141	L	A	1.1495
142	F	A	1.2801
143	K	A	-0.8254
144	K	A	-0.8544
145	I	A	0.8773
146	S	A	0.0359