Project name: 5c8962398cc14c8

Chain sequence(s)	A: QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGVNWIKQAPGQGLQWMGWINPNTGEPTFDDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCSRSRGKNEAWFAYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:41)

• Minimal score value: -3.643
• Maximal score value: 0.8314
• Average score: -0.7537
• Total score value: -90.4451

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.4482
2	V	A	-0.8292
3	Q	A	-1.6654
4	L	A	0.0000
5	Q	A	-2.1716
6	Q	A	-1.4510
7	S	A	-1.0886
8	G	A	-0.8736
9	S	A	-0.0264
11	E	A	0.0715
12	L	A	0.8314
13	K	A	-0.9354
14	K	A	-2.1689
15	P	A	-2.1879
16	G	A	-1.5597
17	A	A	-1.0914
18	S	A	-1.2291
19	V	A	0.0000
20	K	A	-1.4217
21	V	A	0.0000
22	S	A	-0.8965
23	C	A	0.0000
24	K	A	-1.6230
25	A	A	0.0000
26	S	A	-1.0957
27	G	A	-0.9949
28	Y	A	-0.4596
29	T	A	-0.2552
30	F	A	0.0000
35	T	A	-0.8691
36	N	A	-1.1857
37	Y	A	-0.8765
38	G	A	-0.7137
39	V	A	0.0000
40	N	A	0.0000
41	W	A	0.0000
42	I	A	0.0000
43	K	A	0.0207
44	Q	A	-0.3035
45	A	A	-0.9052
46	P	A	-1.0839
47	G	A	-1.1692
48	Q	A	-1.5770
49	G	A	-0.6418
50	L	A	0.7548
51	Q	A	-0.2523
52	W	A	0.1385
53	M	A	0.0000
54	G	A	0.0000
55	W	A	0.0238
56	I	A	0.0000
57	N	A	-0.9904
58	P	A	0.0000
59	N	A	-1.6807
62	T	A	-1.1172
63	G	A	-1.1589
64	E	A	-1.3487
65	P	A	-0.5955
66	T	A	-0.7791
67	F	A	-1.4242
68	D	A	-2.5911
69	D	A	-3.6430
70	D	A	-3.4965
71	F	A	0.0000
72	K	A	-3.2243
74	G	A	-1.9277
75	R	A	-1.4845
76	F	A	0.0000
77	A	A	-0.6977
78	F	A	0.0000
79	S	A	-0.3346
80	L	A	-0.2600
81	D	A	-0.3666
82	T	A	-0.3751
83	S	A	0.1330
84	V	A	0.6045
85	S	A	-0.0679
86	T	A	0.0000
87	A	A	0.0000
88	Y	A	-0.3747
89	L	A	0.0000
90	Q	A	-1.0534
91	I	A	0.0000
92	S	A	-1.0775
93	S	A	-1.2379
94	L	A	0.0000
95	K	A	-2.8534
96	A	A	-2.0891
97	D	A	-2.3892
98	D	A	0.0000
99	T	A	-0.7592
100	A	A	0.0000
101	V	A	0.4964
102	Y	A	0.0000
103	F	A	0.1954
104	C	A	0.0000
105	S	A	0.0000
106	R	A	0.0000
107	S	A	-0.9550
108	R	A	-2.1656
109	G	A	-2.4881
110	K	A	-3.2009
111	N	A	-3.1053
112	E	A	-2.8981
113	A	A	-1.1690
114	W	A	0.1899
115	F	A	0.7409
116	A	A	0.2209
117	Y	A	0.1724
118	W	A	0.1549
119	G	A	-1.0329
120	Q	A	-1.3875
121	G	A	-0.5473
122	T	A	0.0000
123	L	A	0.6762
124	V	A	0.0000
125	T	A	-0.1678
126	V	A	0.0000
127	S	A	-1.1299
128	S	A	-1.1739