Project name: 5c8b957ebfb246f

Chain sequence(s)	A: AVQLVDSGGGLVQPGGSLRLSCVASGSFYSINRMGWYRQAPGKQRELVADITSGGGTNYADSVKGRFTISRDNAKNTVYLQMTSLKPEDTAVYYCNAGVRIQWSSNNMGHWGKGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:10)

• Minimal score value: -3.2054
• Maximal score value: 1.5933
• Average score: -0.7088
• Total score value: -85.0532

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.2722
2	V	A	-0.3189
3	Q	A	-1.0105
4	L	A	0.0000
5	V	A	0.6128
6	D	A	0.0000
7	S	A	-0.1407
8	G	A	-0.5081
9	G	A	0.3673
10	G	A	0.7377
11	L	A	1.3119
12	V	A	0.0000
13	Q	A	-1.3684
14	P	A	-1.5393
15	G	A	-1.3475
16	G	A	-0.8797
17	S	A	-1.1346
18	L	A	-1.1233
19	R	A	-2.3935
20	L	A	0.0000
21	S	A	-0.3627
22	C	A	0.0000
23	V	A	0.3656
24	A	A	0.0000
25	S	A	-0.5184
26	G	A	-0.6019
27	S	A	-0.2605
28	F	A	0.5905
29	Y	A	0.8027
30	S	A	-0.1942
31	I	A	0.0000
32	N	A	-1.6541
33	R	A	-2.1406
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	Y	A	-0.2035
38	R	A	0.0000
39	Q	A	-1.8299
40	A	A	-1.7260
41	P	A	-1.5503
42	G	A	-1.8862
43	K	A	-3.1820
44	Q	A	-3.2054
45	R	A	-2.8786
46	E	A	-2.3250
47	L	A	-0.8137
48	V	A	0.0000
49	A	A	0.0000
50	D	A	0.0000
51	I	A	0.0000
52	T	A	-1.4124
53	S	A	-1.4593
54	G	A	-1.1984
55	G	A	-1.3207
56	G	A	-1.0440
57	T	A	-0.9021
58	N	A	-1.1259
59	Y	A	-1.1431
60	A	A	-1.4914
61	D	A	-2.5436
62	S	A	-1.6315
63	V	A	0.0000
64	K	A	-2.7261
65	G	A	-1.7112
66	R	A	-1.6731
67	F	A	0.0000
68	T	A	-1.2015
69	I	A	0.0000
70	S	A	-0.6986
71	R	A	-1.0631
72	D	A	-1.5702
73	N	A	-2.0175
74	A	A	-1.5090
75	K	A	-2.1334
76	N	A	-1.5163
77	T	A	0.0000
78	V	A	0.0000
79	Y	A	-0.6597
80	L	A	0.0000
81	Q	A	-2.0679
82	M	A	0.0000
83	T	A	-1.1577
84	S	A	-0.9921
85	L	A	0.0000
86	K	A	-2.2478
87	P	A	-1.8314
88	E	A	-2.3483
89	D	A	0.0000
90	T	A	-0.4807
91	A	A	0.0000
92	V	A	0.5694
93	Y	A	0.0000
94	Y	A	-0.0070
95	C	A	0.0000
96	N	A	-0.3735
97	A	A	0.0000
98	G	A	-1.2059
99	V	A	0.0000
100	R	A	-0.9626
101	I	A	0.0165
102	Q	A	-0.5322
103	W	A	0.4858
104	S	A	-0.3202
105	S	A	-0.7690
106	N	A	-1.6407
107	N	A	-1.5367
108	M	A	-0.3368
109	G	A	-0.6348
110	H	A	-0.1920
111	W	A	0.1031
112	G	A	-0.4474
113	K	A	-1.3001
114	G	A	0.0000
115	T	A	0.4624
116	L	A	1.5933
117	V	A	0.0000
118	T	A	0.3233
119	V	A	0.0000
120	S	A	-0.8889