Project name: d7578e7bdc27bccb5a2a58bc0a0b7b8e

Status: done

Started: 2026-03-07 00:22:46
Settings
Chain sequence(s) B: SLEEEAEKLLEEAKELVEEAKKLEEEAYKEVVEVIKKKGYEAFDEAVKKLEEWIKEADKLYAKAAKLEDEYEKLSGEPAEGSGC
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:28)
Show buried residues

Minimal score value
-4.5906
Maximal score value
0.0975
Average score
-2.5058
Total score value
-210.4832

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -1.2347
2 L B -0.9002
3 E B -3.1083
4 E B -3.9794
5 E B -3.7561
6 A B 0.0000
7 E B -4.5220
8 K B -4.5906
9 L B -3.9846
10 L B -3.8391
11 E B -4.4086
12 E B -4.2248
13 A B 0.0000
14 K B -4.1425
15 E B -4.3511
16 L B -3.4599
17 V B 0.0000
18 E B -4.5135
19 E B -4.1433
20 A B 0.0000
21 K B -4.1968
22 K B -4.3698
23 L B -3.4258
24 E B -3.6305
25 E B -3.8469
26 E B -3.2501
27 A B 0.0000
28 Y B -0.8797
29 K B -2.3624
30 E B -1.9091
31 V B -0.7708
32 V B -0.3288
33 E B -2.4905
34 V B 0.0000
35 I B -1.6153
36 K B -2.8840
37 K B -3.3445
38 K B -3.0954
39 G B -1.5030
40 Y B -0.3627
41 E B -1.7287
42 A B -1.6261
43 F B -0.3978
44 D B -2.4652
45 E B -3.0820
46 A B 0.0000
47 V B -1.7339
48 K B -3.5607
49 K B -2.9453
50 L B -2.7534
51 E B -3.7321
52 E B -4.1026
53 W B -3.1276
54 I B -3.3477
55 K B -4.3844
56 E B -3.9767
57 A B 0.0000
58 D B -3.8878
59 K B -3.5639
60 L B -2.9446
61 Y B -2.4726
62 A B -1.9431
63 K B -2.5694
64 A B 0.0000
65 A B -1.8446
66 K B -2.9562
67 L B 0.0000
68 E B -3.4574
69 D B -3.6935
70 E B -3.3253
71 Y B -3.4971
72 E B -3.4056
73 K B -3.2220
74 L B -2.2638
75 S B -2.6465
76 G B -2.4217
77 E B -3.0740
78 P B -2.4443
79 A B -2.4228
80 E B -2.4468
81 G B -1.4340
82 S B -1.3010
83 G B -0.9537
84 C B 0.0975
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018