Project name: Mb5-11_I18L_I104L_VVLLVV_Lib1_Top1

Status: done

Started: 2026-07-06 06:58:56
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTLTVYAVTWYPRYGYGESGPVSVNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:56)
Show buried residues

Minimal score value
-2.8118
Maximal score value
1.3957
Average score
-0.7456
Total score value
-81.2741

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2279
2 Q A -0.9478
3 A A -1.0762
4 N A -1.7800
5 S A -1.3718
6 G A 0.0000
7 S A -1.3806
8 L A 0.0000
9 E A -1.9459
10 V A 0.0000
11 V A 0.1165
12 E A -1.4154
13 A A -1.3441
14 S A -1.6371
15 P A -1.9976
16 T A -1.2527
17 S A -1.2235
18 L A 0.0000
19 Q A -0.9479
20 V A 0.0000
21 S A -1.2040
22 W A 0.0000
23 D A -2.4949
24 A A -1.4574
25 F A 0.0000
26 H A -0.8476
27 R A -0.2879
28 Y A 0.6405
29 H A -0.0193
30 N A -0.6684
31 G A 0.1379
32 F A 1.3957
33 T A 0.6605
34 H A 0.1002
35 P A -0.3522
36 V A -1.0133
37 R A -1.2728
38 Y A -0.8928
39 Y A 0.0000
40 R A -0.7156
41 V A 0.0000
42 T A -0.6456
43 Y A -0.3795
44 G A -0.6348
45 E A -1.3861
46 T A -1.1440
47 G A -1.1734
48 G A -1.3136
49 N A -1.5088
50 S A -0.8793
51 P A -0.3935
52 V A 0.3053
53 Q A -1.2016
54 E A -1.7925
55 F A -0.6560
56 T A -0.1669
57 V A -0.4656
58 P A -1.0039
59 G A -1.2600
60 S A -1.3290
61 K A -1.9948
62 S A -1.3791
63 T A -0.9413
64 A A 0.0000
65 T A -0.3948
66 L A 0.0000
67 S A -0.7701
68 G A -0.9786
69 L A 0.0000
70 K A -2.3878
71 P A -2.1019
72 G A -1.3701
73 V A -1.2335
74 D A -2.1542
75 Y A 0.0000
76 T A -0.7548
77 L A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.1738
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5964
85 Y A 0.0000
86 P A -0.4481
87 R A -1.1020
88 Y A 0.7271
89 G A 0.8312
90 Y A 1.2140
91 G A 0.4224
92 E A -0.4593
93 S A 0.0000
94 G A -0.6667
95 P A -0.3708
96 V A -0.3767
97 S A -0.5385
98 V A -0.7285
99 N A -1.7524
100 Y A -1.6541
101 R A -2.5944
102 T A 0.0000
103 E A -2.5249
104 L A -1.2913
105 D A -2.7238
106 K A -2.8118
107 P A -1.7899
108 S A -1.6392
109 Q A -1.6616
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018