Project name: KAP4

Status: done

Started: 2026-07-08 19:09:20
Settings
Chain sequence(s) A: MASCSTSGTCGSSCCQPSETSQPSQTSSGIGGGIGYGQEGSGGSVSTRIRWHPDHVEGTLKPYLVSTPPSQLHHAEASRPSYCGQSCCRPANFCHCCEKT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:42)
Show buried residues

Minimal score value
-2.7031
Maximal score value
2.7233
Average score
-0.6578
Total score value
-65.7781

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0916
2 A A 0.5545
3 S A -0.2691
4 C A -0.3460
5 S A -0.2862
6 T A -0.3858
7 S A -0.7420
8 G A -0.8299
9 T A -0.3899
10 C A -0.1854
11 G A 0.0000
12 S A -0.9068
13 S A -0.6476
14 C A -0.3299
15 C A 0.0000
16 Q A -1.7804
17 P A -1.3449
18 S A -1.2844
19 E A -2.3847
20 T A -1.4654
21 S A -1.3816
22 Q A -2.1405
23 P A -1.5198
24 S A -1.3185
25 Q A -1.5783
26 T A -0.7395
27 S A -0.5621
28 S A 0.0323
29 G A 0.4894
30 I A 1.9641
31 G A 1.0394
32 G A 0.3244
33 G A 0.6729
34 I A 1.4092
35 G A 0.1204
36 Y A -0.0741
37 G A -0.5825
38 Q A -1.8214
39 E A -2.5306
40 G A -1.9139
41 S A -1.1196
42 G A -0.8123
43 G A -0.4019
44 S A 0.3527
45 V A 1.1473
46 S A 0.2936
47 T A -0.2600
48 R A -1.0840
49 I A 0.3817
50 R A -1.1023
51 W A -0.1284
52 H A -1.3439
53 P A -1.4725
54 D A -2.1626
55 H A -1.7909
56 V A -0.1044
57 E A -1.5345
58 G A -0.8174
59 T A -0.2005
60 L A 0.6608
61 K A -0.5984
62 P A 0.7021
63 Y A 2.1990
64 L A 2.6963
65 V A 2.7233
66 S A 1.1362
67 T A 0.3148
68 P A -0.2899
69 P A -0.4567
70 S A -0.6557
71 Q A -1.0356
72 L A 0.0497
73 H A -1.3279
74 H A -1.6801
75 A A -1.4157
76 E A -2.5037
77 A A -1.5795
78 S A -1.8785
79 R A -2.4452
80 P A -1.8142
81 S A -1.4206
82 Y A -0.8366
83 C A 0.0000
84 G A -0.7894
85 Q A -1.4589
86 S A -1.2577
87 C A -1.1863
88 C A -1.6154
89 R A -2.2462
90 P A -1.2152
91 A A -1.0350
92 N A -1.1012
93 F A -0.2934
94 C A -0.8036
95 H A -1.0911
96 C A -1.0779
97 C A 0.0000
98 E A -2.3911
99 K A -2.7031
100 T A -1.8536
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018