| Chain sequence(s) |
A: QTTPNSEGWHDGYYYSWWTDGGAQATYTNLPGGCYEISWSGGGNLVGGKGWNPGLNNRAIHFDGVYQPNGNSYLAVYGWTRNPLVEYYIVENFGTYDPSSDATDLGTVYCDGSTYRLGKSTRYNAPSIDGIQTFDQYWSVRQNKRSSGTVQTGCHFDAWARAGLNVNGDHYYQIVAVEGYFSSGYARICVADVG
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:00)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:00:45)
[INFO] Auto_mut: Residue number 181 from chain A and a score of 1.661 (phenylalanine)
selected for automated muatation (00:00:46)
[INFO] Auto_mut: Residue number 180 from chain A and a score of 1.266 (tyrosine) selected
for automated muatation (00:00:46)
[INFO] Auto_mut: Residue number 109 from chain A and a score of 1.200 (tyrosine) selected
for automated muatation (00:00:46)
[INFO] Auto_mut: Residue number 193 from chain A and a score of 0.699 (valine) selected for
automated muatation (00:00:46)
[INFO] Auto_mut: Residue number 108 from chain A and a score of 0.570 (valine) selected for
automated muatation (00:00:46)
[INFO] Auto_mut: Residue number 131 from chain A and a score of 0.535 (isoleucine) selected
for automated muatation (00:00:46)
[INFO] Auto_mut: Mutating residue number 180 from chain A (tyrosine) into glutamic acid (00:00:46)
[INFO] Auto_mut: Mutating residue number 181 from chain A (phenylalanine) into glutamic acid
Mutating residue number 181 from chain A (phenylalanine) into glutamic acid (00:00:46)
[INFO] Auto_mut: Mutating residue number 181 from chain A (phenylalanine) into aspartic acid
Mutating residue number 181 from chain A (phenylalanine) into aspartic acid (00:00:46)
[INFO] Auto_mut: Mutating residue number 181 from chain A (phenylalanine) into arginine (00:01:17)
[INFO] Auto_mut: Mutating residue number 181 from chain A (phenylalanine) into lysine (00:01:23)
[INFO] Auto_mut: Mutating residue number 180 from chain A (tyrosine) into lysine (00:01:28)
[INFO] Auto_mut: Mutating residue number 180 from chain A (tyrosine) into aspartic acid (00:02:00)
[INFO] Auto_mut: Mutating residue number 109 from chain A (tyrosine) into glutamic acid (00:02:14)
[INFO] Auto_mut: Mutating residue number 180 from chain A (tyrosine) into arginine (00:02:33)
[INFO] Auto_mut: Mutating residue number 109 from chain A (tyrosine) into aspartic acid (00:02:33)
[INFO] Auto_mut: Mutating residue number 109 from chain A (tyrosine) into lysine (00:02:48)
[INFO] Auto_mut: Mutating residue number 109 from chain A (tyrosine) into arginine (00:03:04)
[INFO] Auto_mut: Mutating residue number 193 from chain A (valine) into glutamic acid (00:03:13)
[INFO] Auto_mut: Mutating residue number 193 from chain A (valine) into aspartic acid (00:03:28)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into glutamic acid (00:03:41)
[INFO] Auto_mut: Mutating residue number 193 from chain A (valine) into lysine (00:03:48)
[INFO] Auto_mut: Mutating residue number 193 from chain A (valine) into arginine (00:04:01)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into lysine (00:04:13)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into aspartic acid (00:04:25)
[INFO] Auto_mut: Mutating residue number 131 from chain A (isoleucine) into glutamic acid (00:04:36)
[INFO] Auto_mut: Mutating residue number 131 from chain A (isoleucine) into aspartic acid (00:04:44)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into arginine (00:04:55)
[INFO] Auto_mut: Mutating residue number 131 from chain A (isoleucine) into lysine (00:05:08)
[INFO] Auto_mut: Mutating residue number 131 from chain A (isoleucine) into arginine (00:05:16)
[INFO] Auto_mut: Effect of mutation residue number 181 from chain A (phenylalanine) into
glutamic acid: Energy difference: 0.8910 kcal/mol, Difference in average
score from the base case: -0.0724 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 181 from chain A (phenylalanine) into
lysine: Energy difference: 0.6924 kcal/mol, Difference in average score
from the base case: -0.0709 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 181 from chain A (phenylalanine) into
aspartic acid: Energy difference: 1.5208 kcal/mol, Difference in average
score from the base case: -0.0626 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 181 from chain A (phenylalanine) into
arginine: Energy difference: -0.0190 kcal/mol, Difference in average score
from the base case: -0.0792 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 180 from chain A (tyrosine) into glutamic
acid: Energy difference: 1.0589 kcal/mol, Difference in average score from
the base case: -0.0174 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 180 from chain A (tyrosine) into lysine:
Energy difference: 1.2184 kcal/mol, Difference in average score from the
base case: -0.0185 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 180 from chain A (tyrosine) into aspartic
acid: Energy difference: 2.0148 kcal/mol, Difference in average score from
the base case: -0.0189 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 180 from chain A (tyrosine) into
arginine: Energy difference: 0.6627 kcal/mol, Difference in average score
from the base case: -0.0266 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 109 from chain A (tyrosine) into glutamic
acid: Energy difference: 0.5544 kcal/mol, Difference in average score from
the base case: -0.0432 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 109 from chain A (tyrosine) into lysine:
Energy difference: 0.0299 kcal/mol, Difference in average score from the
base case: -0.0414 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 109 from chain A (tyrosine) into aspartic
acid: Energy difference: 0.5521 kcal/mol, Difference in average score from
the base case: -0.0429 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 109 from chain A (tyrosine) into
arginine: Energy difference: 0.1456 kcal/mol, Difference in average score
from the base case: -0.0435 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 193 from chain A (valine) into glutamic
acid: Energy difference: 0.9915 kcal/mol, Difference in average score from
the base case: -0.0533 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 193 from chain A (valine) into lysine:
Energy difference: -0.7401 kcal/mol, Difference in average score from the
base case: -0.0515 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 193 from chain A (valine) into aspartic
acid: Energy difference: 1.1388 kcal/mol, Difference in average score from
the base case: -0.0518 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 193 from chain A (valine) into arginine:
Energy difference: 0.1613 kcal/mol, Difference in average score from the
base case: -0.0452 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into glutamic
acid: Energy difference: 2.0795 kcal/mol, Difference in average score from
the base case: -0.0103 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into lysine:
Energy difference: 1.3339 kcal/mol, Difference in average score from the
base case: -0.0113 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into aspartic
acid: Energy difference: 3.8137 kcal/mol, Difference in average score from
the base case: -0.0081 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into arginine:
Energy difference: 1.8589 kcal/mol, Difference in average score from the
base case: -0.0204 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 131 from chain A (isoleucine) into
glutamic acid: Energy difference: 0.4156 kcal/mol, Difference in average
score from the base case: -0.0703 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 131 from chain A (isoleucine) into
lysine: Energy difference: 0.4642 kcal/mol, Difference in average score
from the base case: -0.0705 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 131 from chain A (isoleucine) into
aspartic acid: Energy difference: 0.6761 kcal/mol, Difference in average
score from the base case: -0.0657 (00:05:49)
[INFO] Auto_mut: Effect of mutation residue number 131 from chain A (isoleucine) into
arginine: Energy difference: -0.1999 kcal/mol, Difference in average score
from the base case: -0.0718 (00:05:49)
[INFO] Main: Simulation completed successfully. (00:05:54)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | Q | A | -1.6460 | |
| 2 | T | A | -1.6265 | |
| 3 | T | A | -0.9452 | |
| 4 | P | A | -1.2618 | |
| 5 | N | A | -1.8452 | |
| 6 | S | A | -1.2372 | |
| 7 | E | A | -1.1673 | |
| 8 | G | A | -0.1039 | |
| 9 | W | A | 0.3080 | |
| 10 | H | A | -0.8258 | |
| 11 | D | A | -1.9012 | |
| 12 | G | A | -1.0412 | |
| 13 | Y | A | -0.3391 | |
| 14 | Y | A | 0.0000 | |
| 15 | Y | A | -0.1999 | |
| 16 | S | A | 0.0000 | |
| 17 | W | A | 0.0000 | |
| 18 | W | A | -0.8532 | |
| 19 | T | A | 0.0000 | |
| 20 | D | A | -2.4215 | |
| 21 | G | A | -2.1734 | |
| 22 | G | A | -1.3520 | |
| 23 | A | A | 0.0000 | |
| 24 | Q | A | -1.9250 | |
| 25 | A | A | 0.0000 | |
| 26 | T | A | -0.6763 | |
| 27 | Y | A | 0.0000 | |
| 28 | T | A | -0.4647 | |
| 29 | N | A | -0.5749 | |
| 30 | L | A | -0.4926 | |
| 31 | P | A | -0.7208 | |
| 32 | G | A | -0.9426 | |
| 33 | G | A | 0.0000 | |
| 34 | C | A | -0.5949 | |
| 35 | Y | A | 0.0000 | |
| 36 | E | A | -0.9550 | |
| 37 | I | A | 0.0000 | |
| 38 | S | A | -0.7189 | |
| 39 | W | A | 0.0000 | |
| 40 | S | A | -0.6513 | |
| 41 | G | A | -0.3378 | |
| 42 | G | A | -0.1650 | |
| 43 | G | A | 0.0000 | |
| 44 | N | A | -0.3396 | |
| 45 | L | A | 0.0000 | |
| 46 | V | A | 0.0000 | |
| 47 | G | A | 0.0000 | |
| 48 | G | A | 0.0000 | |
| 49 | K | A | 0.0000 | |
| 50 | G | A | 0.0000 | |
| 51 | W | A | 0.0680 | |
| 52 | N | A | -0.0901 | |
| 53 | P | A | -0.4614 | |
| 54 | G | A | 0.0000 | |
| 55 | L | A | -0.2382 | |
| 56 | N | A | -1.3074 | |
| 57 | N | A | -1.7803 | |
| 58 | R | A | 0.0000 | |
| 59 | A | A | -0.7617 | |
| 60 | I | A | 0.0000 | |
| 61 | H | A | -0.6002 | |
| 62 | F | A | 0.0000 | |
| 63 | D | A | -1.0295 | |
| 64 | G | A | -0.6768 | |
| 65 | V | A | -0.1703 | |
| 66 | Y | A | 0.0000 | |
| 67 | Q | A | -1.4345 | |
| 68 | P | A | -1.2912 | |
| 69 | N | A | -1.5628 | |
| 70 | G | A | -0.5481 | |
| 71 | N | A | -0.0076 | |
| 72 | S | A | 0.0000 | |
| 73 | Y | A | 0.0000 | |
| 74 | L | A | 0.0000 | |
| 75 | A | A | 0.0000 | |
| 76 | V | A | 0.0000 | |
| 77 | Y | A | 0.0000 | |
| 78 | G | A | 0.0000 | |
| 79 | W | A | 0.0000 | |
| 80 | T | A | 0.0000 | |
| 81 | R | A | -1.9808 | |
| 82 | N | A | -2.3271 | |
| 83 | P | A | -1.6882 | |
| 84 | L | A | -1.0031 | |
| 85 | V | A | 0.0000 | |
| 86 | E | A | 0.0000 | |
| 87 | Y | A | 0.0000 | |
| 88 | Y | A | 0.0000 | |
| 89 | I | A | 0.0000 | |
| 90 | V | A | 0.0000 | |
| 91 | E | A | 0.0000 | |
| 92 | N | A | -1.0223 | |
| 93 | F | A | -0.5437 | |
| 94 | G | A | -0.7739 | |
| 95 | T | A | -0.3118 | |
| 96 | Y | A | 0.2037 | |
| 97 | D | A | -0.5669 | |
| 98 | P | A | 0.0000 | |
| 99 | S | A | 0.0000 | |
| 100 | S | A | -1.4059 | |
| 101 | D | A | -2.2763 | |
| 102 | A | A | -1.6200 | |
| 103 | T | A | -1.4950 | |
| 104 | D | A | -2.2365 | |
| 105 | L | A | -1.0964 | |
| 106 | G | A | -0.7826 | |
| 107 | T | A | -0.1921 | |
| 108 | V | A | 0.5695 | |
| 109 | Y | A | 1.1999 | |
| 110 | C | A | 0.0000 | |
| 111 | D | A | -0.5552 | |
| 112 | G | A | -0.5381 | |
| 113 | S | A | 0.0000 | |
| 114 | T | A | -0.2107 | |
| 115 | Y | A | 0.0000 | |
| 116 | R | A | -0.9142 | |
| 117 | L | A | 0.0000 | |
| 118 | G | A | 0.0000 | |
| 119 | K | A | -1.1266 | |
| 120 | S | A | -1.0942 | |
| 121 | T | A | -0.7298 | |
| 122 | R | A | -1.0296 | |
| 123 | Y | A | 0.0654 | |
| 124 | N | A | -0.7573 | |
| 125 | A | A | -0.3734 | |
| 126 | P | A | -0.4835 | |
| 127 | S | A | -0.4637 | |
| 128 | I | A | -0.1772 | |
| 129 | D | A | -0.9858 | |
| 130 | G | A | -0.4308 | |
| 131 | I | A | 0.5353 | |
| 132 | Q | A | -0.6054 | |
| 133 | T | A | -0.4636 | |
| 134 | F | A | 0.0000 | |
| 135 | D | A | -0.6731 | |
| 136 | Q | A | 0.0000 | |
| 137 | Y | A | 0.0000 | |
| 138 | W | A | 0.0000 | |
| 139 | S | A | 0.0000 | |
| 140 | V | A | 0.0000 | |
| 141 | R | A | 0.0000 | |
| 142 | Q | A | -2.1458 | |
| 143 | N | A | -2.4677 | |
| 144 | K | A | -2.2298 | |
| 145 | R | A | -1.4858 | |
| 146 | S | A | -0.7090 | |
| 147 | S | A | -0.7538 | |
| 148 | G | A | -0.6514 | |
| 149 | T | A | -0.6361 | |
| 150 | V | A | 0.0000 | |
| 151 | Q | A | -1.5021 | |
| 152 | T | A | 0.0000 | |
| 153 | G | A | -1.4078 | |
| 154 | C | A | -0.7493 | |
| 155 | H | A | 0.0000 | |
| 156 | F | A | 0.0000 | |
| 157 | D | A | -2.1750 | |
| 158 | A | A | 0.0000 | |
| 159 | W | A | 0.0000 | |
| 160 | A | A | -1.8820 | |
| 161 | R | A | -2.4041 | |
| 162 | A | A | -1.5720 | |
| 163 | G | A | -1.2983 | |
| 164 | L | A | -1.2399 | |
| 165 | N | A | -1.6716 | |
| 166 | V | A | -1.8506 | |
| 167 | N | A | -2.2765 | |
| 168 | G | A | -2.3557 | |
| 169 | D | A | -2.5495 | |
| 170 | H | A | -1.3728 | |
| 171 | Y | A | -0.3443 | |
| 172 | Y | A | 0.0000 | |
| 173 | Q | A | 0.0000 | |
| 174 | I | A | 0.0000 | |
| 175 | V | A | 0.0000 | |
| 176 | A | A | 0.0000 | |
| 177 | V | A | 0.0000 | |
| 178 | E | A | -0.0711 | |
| 179 | G | A | 0.0000 | |
| 180 | Y | A | 1.2658 | |
| 181 | F | A | 1.6608 | |
| 182 | S | A | 0.0000 | |
| 183 | S | A | -0.6201 | |
| 184 | G | A | -0.9510 | |
| 185 | Y | A | -0.6828 | |
| 186 | A | A | 0.0000 | |
| 187 | R | A | -1.5335 | |
| 188 | I | A | 0.0000 | |
| 189 | C | A | -0.4231 | |
| 190 | V | A | 0.0000 | |
| 191 | A | A | -0.2808 | |
| 192 | D | A | -0.5288 | |
| 193 | V | A | 0.6988 | |
| 194 | G | A | -0.3503 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VK193A | -0.7401 | -0.0515 | View | CSV | PDB |
| IR131A | -0.1999 | -0.0718 | View | CSV | PDB |
| FR181A | -0.019 | -0.0792 | View | CSV | PDB |
| YK109A | 0.0299 | -0.0414 | View | CSV | PDB |
| YR109A | 0.1456 | -0.0435 | View | CSV | PDB |
| VR193A | 0.1613 | -0.0452 | View | CSV | PDB |
| IE131A | 0.4156 | -0.0703 | View | CSV | PDB |
| FK181A | 0.6924 | -0.0709 | View | CSV | PDB |
| YR180A | 0.6627 | -0.0266 | View | CSV | PDB |
| YE180A | 1.0589 | -0.0174 | View | CSV | PDB |
| VR108A | 1.8589 | -0.0204 | View | CSV | PDB |
| VK108A | 1.3339 | -0.0113 | View | CSV | PDB |