Project name: query_structure

Status: done

Started: 2026-03-16 23:21:17
Settings
Chain sequence(s) A: GGSVPCIETCVWTGCFLVPGCSCKSDKKCYLN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)
Show buried residues

Minimal score value
-2.7237
Maximal score value
2.7196
Average score
0.2671
Total score value
8.5468

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.6703
2 G A -0.3923
3 S A 0.0614
4 V A 1.7135
5 P A 0.8319
6 C A 1.8753
7 I A 2.4706
8 E A 0.0000
9 T A 0.4319
10 C A 0.0000
11 V A 1.5317
12 W A 1.8187
13 T A 1.2844
14 G A 0.7562
15 C A 1.6045
16 F A 2.5342
17 L A 2.7196
18 V A 1.9700
19 P A 0.6527
20 G A -0.1075
21 C A 0.0000
22 S A -0.5455
23 C A -0.9103
24 K A -2.1756
25 S A -2.0522
26 D A -2.7237
27 K A -2.1061
28 K A -1.7619
29 C A 0.0000
30 Y A 0.0341
31 L A 0.5639
32 N A -0.8624
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018