Project name: ef657fb3437b0e2 [mutate: VA41A, FA214A, FA217A]

Status: done

Started: 2026-07-19 13:14:49
Settings
Chain sequence(s) A: YPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFKGFA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues FA217A,FA214A,VA41A
Energy difference between WT (input) and mutated protein (by FoldX) 3.86702 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:57)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:02:14)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:06)
Show buried residues

Minimal score value
-2.5785
Maximal score value
0.7162
Average score
-0.6859
Total score value
-149.5204

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 0.7162
2 P A -0.1688
3 Q A -1.1043
4 S A -0.6831
5 I A 0.0000
6 D A -1.0076
7 W A -1.1608
8 R A -1.4618
9 A A -1.2966
10 K A -1.9720
11 G A -1.3051
12 A A 0.0000
13 V A -0.5436
14 T A 0.0000
15 P A -0.6645
16 V A -0.7926
17 K A -0.9324
18 N A -1.5504
19 Q A 0.0000
20 G A -1.0901
21 A A -0.5661
22 C A 0.0000
23 G A -0.8467
24 S A 0.0000
25 C A -0.4301
26 W A 0.0000
27 A A 0.0000
28 F A 0.0000
29 S A 0.0000
30 T A 0.0000
31 I A 0.0000
32 A A -0.1617
33 T A 0.0000
34 V A 0.0000
35 E A 0.0000
36 G A 0.0000
37 I A 0.0000
38 N A 0.0000
39 K A -0.5471
40 I A 0.0271
41 A A -0.0329 mutated: VA41A
42 T A -0.4808
43 G A -0.8361
44 N A -1.3045
45 L A -0.3436
46 L A -0.6617
47 E A -1.3585
48 L A 0.0000
49 S A 0.0000
50 E A 0.0000
51 Q A 0.0000
52 E A 0.0000
53 L A 0.0000
54 V A 0.0000
55 D A 0.0000
56 C A 0.0000
57 D A 0.0000
58 K A -1.9602
59 H A -1.4976
60 S A 0.0000
61 Y A -0.2352
62 G A 0.0000
63 C A -1.1416
64 K A -1.6511
65 G A -0.7417
66 G A -0.2665
67 Y A 0.5220
68 Q A 0.0000
69 T A -0.3721
70 T A -0.4940
71 S A 0.0000
72 L A 0.0000
73 Q A -0.8857
74 Y A -1.3006
75 V A 0.0000
76 A A 0.0000
77 N A -2.0047
78 N A -1.9631
79 G A 0.0000
80 V A 0.0000
81 H A 0.0000
82 T A 0.0000
83 S A -1.0786
84 K A -1.8385
85 V A -0.8765
86 Y A 0.0000
87 P A -0.6822
88 Y A -0.8601
89 Q A -1.2011
90 A A -1.3942
91 K A -2.2172
92 Q A -1.6083
93 Y A -1.0928
94 K A -1.5687
95 C A -1.1898
96 R A -1.3491
97 A A -1.3385
98 T A -1.2315
99 D A -2.2084
100 K A -1.8565
101 P A -1.3754
102 G A -1.3615
103 P A -1.5622
104 K A -2.5015
105 V A 0.0000
106 K A -2.3093
107 I A 0.0000
108 T A -0.8246
109 G A -0.9098
110 Y A -0.9343
111 K A -2.1683
112 R A -2.0952
113 V A 0.0000
114 P A -0.9796
115 S A -1.0900
116 N A -1.4964
117 C A -1.1531
118 E A -0.9772
119 T A -0.3535
120 S A -0.4331
121 F A 0.0000
122 L A 0.0000
123 G A -0.1241
124 A A -0.4595
125 L A 0.0000
126 A A -0.5053
127 N A -0.9683
128 Q A 0.0000
129 P A 0.0000
130 L A 0.0000
131 S A 0.0000
132 V A 0.0000
133 L A -0.2365
134 V A 0.0000
135 E A 0.0000
136 A A 0.0000
137 G A -1.6510
138 G A -1.3887
139 K A -1.7566
140 P A -1.1702
141 F A 0.0000
142 Q A -0.8707
143 L A 0.1256
144 Y A 0.0000
145 K A -2.0546
146 S A -1.3180
147 G A -1.0394
148 V A -1.1473
149 F A 0.0000
150 D A -2.0269
151 G A -1.3470
152 P A -1.0061
153 C A -1.0254
154 G A -0.8502
155 T A -1.2492
156 K A -2.0534
157 L A -1.3633
158 D A -2.0613
159 H A 0.0000
160 A A 0.0000
161 V A 0.0000
162 T A 0.0000
163 A A 0.0000
164 V A 0.0000
165 G A 0.0000
166 Y A 0.0000
167 G A 0.0000
168 T A -1.3097
169 S A -1.5011
170 D A -2.3723
171 G A -1.8686
172 K A -1.9419
173 N A -1.6270
174 Y A -0.9046
175 I A 0.0000
176 I A 0.0000
177 I A 0.0000
178 K A 0.0000
179 N A 0.0000
180 S A 0.0000
181 W A -0.9292
182 G A 0.0000
183 P A -1.7563
184 N A -2.2444
185 W A 0.0000
186 G A -1.8071
187 E A -2.1028
188 K A -2.5785
189 G A 0.0000
190 Y A 0.0000
191 M A 0.0000
192 R A -0.7457
193 L A 0.0000
194 K A -1.3830
195 R A 0.0000
196 Q A -1.5368
197 S A -1.1432
198 G A -1.2315
199 N A -1.8278
200 S A -1.5428
201 Q A -1.6889
202 G A 0.0000
203 T A 0.0000
204 C A 0.0000
205 G A 0.0000
206 V A 0.0000
207 Y A 0.0000
208 K A -0.7664
209 S A -0.5246
210 S A 0.0000
211 Y A -0.8330
212 Y A -0.6797
213 P A 0.0000
214 A A -0.5480 mutated: FA214A
215 K A -0.5583
216 G A -0.7053
217 A A -0.4009 mutated: FA217A
218 A A -0.2443
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018