Project name: 5deeb8bf9a07699

Chain sequence(s)	A: SKIKGSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:56)

• Minimal score value: -4.3387
• Maximal score value: 3.3322
• Average score: -1.046
• Total score value: -114.0192

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.7059
2	K	A	-1.3334
3	I	A	0.3118
4	K	A	-1.6948
5	G	A	-1.3732
6	S	A	-1.6814
7	R	A	-2.5976
8	H	A	-1.3221
9	W	A	0.9047
10	G	A	1.7366
11	F	A	3.3322
12	I	A	2.2829
13	L	A	2.0369
14	G	A	-0.3599
15	K	A	-2.4851
16	R	A	-2.3680
17	G	A	-2.1422
18	E	A	-2.6887
19	P	A	-1.5892
20	P	A	-1.4760
21	P	A	-1.4926
22	G	A	-1.6016
23	K	A	-2.4020
24	P	A	-1.9741
25	A	A	-1.9831
26	D	A	-2.9451
27	D	A	-2.8672
28	A	A	-1.2421
29	G	A	-0.4949
30	L	A	-0.2485
31	V	A	0.0323
32	S	A	-1.2342
33	R	A	-1.9351
34	H	A	-1.1115
35	W	A	0.9777
36	G	A	0.0000
37	F	A	2.8614
38	I	A	1.8443
39	L	A	1.4120
40	G	A	-1.1493
41	K	A	-3.3041
42	R	A	-3.2803
43	G	A	-3.0232
44	E	A	-2.8583
45	P	A	-1.8817
46	P	A	-1.5964
47	P	A	-1.4728
48	G	A	-1.5967
49	K	A	-2.3678
50	P	A	-2.1602
51	A	A	-1.8936
52	D	A	-3.1485
53	D	A	-2.7438
54	A	A	-1.5521
55	G	A	-0.1440
56	L	A	0.9930
57	V	A	1.0570
58	S	A	-0.0139
59	R	A	-0.9042
60	H	A	-1.1741
61	W	A	0.1982
62	G	A	1.5324
63	F	A	2.6132
64	I	A	1.5157
65	L	A	1.1885
66	G	A	-1.5228
67	K	A	-3.8848
68	R	A	-4.3387
69	G	A	-3.7692
70	E	A	-3.2955
71	P	A	-2.1863
72	P	A	-1.5556
73	P	A	-1.3674
74	G	A	-1.6214
75	K	A	-2.3708
76	P	A	-1.9636
77	A	A	-2.0366
78	D	A	-2.9243
79	D	A	-2.6685
80	A	A	-1.0644
81	G	A	0.2129
82	L	A	1.6635
83	V	A	1.6312
84	S	A	0.1448
85	R	A	-1.4144
86	H	A	-1.2665
87	W	A	0.3130
88	G	A	1.1869
89	F	A	2.7458
90	I	A	1.7283
91	L	A	1.2605
92	G	A	-1.3695
93	K	A	-3.2969
94	R	A	-4.2593
95	G	A	-3.8415
96	E	A	-3.2693
97	P	A	-1.9494
98	P	A	-1.3966
99	P	A	-1.4639
100	G	A	-1.6039
101	K	A	-2.4351
102	P	A	-2.0679
103	A	A	-1.9094
104	D	A	-3.1123
105	D	A	-2.6284
106	A	A	-0.6400
107	G	A	-0.0018
108	L	A	1.9466
109	V	A	2.4270