Project name: 5deeb8bf9a07699

Status: done

Started: 2026-06-18 13:44:45
Settings
Chain sequence(s) A: SKIKGSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:56)
Show buried residues

Minimal score value
-4.3387
Maximal score value
3.3322
Average score
-1.046
Total score value
-114.0192

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -0.7059
2 K A -1.3334
3 I A 0.3118
4 K A -1.6948
5 G A -1.3732
6 S A -1.6814
7 R A -2.5976
8 H A -1.3221
9 W A 0.9047
10 G A 1.7366
11 F A 3.3322
12 I A 2.2829
13 L A 2.0369
14 G A -0.3599
15 K A -2.4851
16 R A -2.3680
17 G A -2.1422
18 E A -2.6887
19 P A -1.5892
20 P A -1.4760
21 P A -1.4926
22 G A -1.6016
23 K A -2.4020
24 P A -1.9741
25 A A -1.9831
26 D A -2.9451
27 D A -2.8672
28 A A -1.2421
29 G A -0.4949
30 L A -0.2485
31 V A 0.0323
32 S A -1.2342
33 R A -1.9351
34 H A -1.1115
35 W A 0.9777
36 G A 0.0000
37 F A 2.8614
38 I A 1.8443
39 L A 1.4120
40 G A -1.1493
41 K A -3.3041
42 R A -3.2803
43 G A -3.0232
44 E A -2.8583
45 P A -1.8817
46 P A -1.5964
47 P A -1.4728
48 G A -1.5967
49 K A -2.3678
50 P A -2.1602
51 A A -1.8936
52 D A -3.1485
53 D A -2.7438
54 A A -1.5521
55 G A -0.1440
56 L A 0.9930
57 V A 1.0570
58 S A -0.0139
59 R A -0.9042
60 H A -1.1741
61 W A 0.1982
62 G A 1.5324
63 F A 2.6132
64 I A 1.5157
65 L A 1.1885
66 G A -1.5228
67 K A -3.8848
68 R A -4.3387
69 G A -3.7692
70 E A -3.2955
71 P A -2.1863
72 P A -1.5556
73 P A -1.3674
74 G A -1.6214
75 K A -2.3708
76 P A -1.9636
77 A A -2.0366
78 D A -2.9243
79 D A -2.6685
80 A A -1.0644
81 G A 0.2129
82 L A 1.6635
83 V A 1.6312
84 S A 0.1448
85 R A -1.4144
86 H A -1.2665
87 W A 0.3130
88 G A 1.1869
89 F A 2.7458
90 I A 1.7283
91 L A 1.2605
92 G A -1.3695
93 K A -3.2969
94 R A -4.2593
95 G A -3.8415
96 E A -3.2693
97 P A -1.9494
98 P A -1.3966
99 P A -1.4639
100 G A -1.6039
101 K A -2.4351
102 P A -2.0679
103 A A -1.9094
104 D A -3.1123
105 D A -2.6284
106 A A -0.6400
107 G A -0.0018
108 L A 1.9466
109 V A 2.4270
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018