Project name: a35-3k7b

Status: done

Started: 2024-11-21 00:44:56
Settings
Chain sequence(s) A: ESCNGLYYQGSCYILHSDYQMFSDAAANCTAESSTLPNKSDVMITWLIDYVEDTWGSDGNPITKTTSDSDVSQEVRKYFCVKTMN
B: HKESCNGLYYQGSCYILHSDYQMFSDAAANCTAESSTLPNKSDVMITWLIDYVEDTWGSDGNPITKTTSDSDVSQEVRKYFCVKTM
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:09)
Show buried residues

Minimal score value
-3.0278
Maximal score value
1.5503
Average score
-0.8092
Total score value
-138.3651

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
98 E A -1.9753
99 S A -1.3068
100 C A -0.7213
101 N A -0.8677
102 G A 0.0000
103 L A 0.0000
104 Y A 0.5683
105 Y A -0.0036
106 Q A -1.0471
107 G A -0.7073
108 S A -0.3331
109 C A 0.0000
110 Y A 0.0000
111 I A 0.4160
112 L A -0.1691
113 H A -0.6032
114 S A -0.8004
115 D A -0.7596
116 Y A 0.2914
117 Q A -0.3038
118 M A -0.0504
119 F A -0.5422
120 S A -0.6939
121 D A -1.4236
122 A A 0.0000
123 A A -0.8577
124 A A -1.0861
125 N A -1.5771
126 C A 0.0000
127 T A -0.9880
128 A A -1.0285
129 E A -1.8815
130 S A -1.2287
131 S A -0.9668
132 T A -0.6956
133 L A 0.0000
134 P A 0.0000
135 N A -1.7882
136 K A -1.6846
137 S A -1.0015
138 D A -1.6434
139 V A 0.0000
140 M A 0.0013
141 I A 1.5503
142 T A 0.7683
143 W A 0.4883
144 L A 0.0000
145 I A -0.4791
146 D A -1.0447
147 Y A -0.4368
148 V A 0.0000
149 E A -1.8766
150 D A -2.5491
151 T A 0.0000
152 W A 0.0000
153 G A 0.0000
154 S A -1.4144
155 D A -2.2787
156 G A -1.2305
157 N A -2.0046
158 P A -1.6219
159 I A 0.0000
160 T A -1.7371
161 K A -1.8491
162 T A -1.2711
163 T A -1.0367
164 S A -1.3983
165 D A -1.9530
169 S A -1.4647
170 D A -2.3100
171 V A -1.4586
172 S A -1.3751
173 Q A -1.7318
174 E A -1.3134
175 V A -0.0893
176 R A -0.5912
177 K A -0.8416
178 Y A 0.0000
179 F A 0.0000
180 C A 0.0000
181 V A -0.2655
182 K A -0.8571
183 T A -0.7017
184 M A -0.8343
185 N A -1.4216
96 H B -2.3554
97 K B -3.0278
98 E B -2.9881
99 S B -1.7082
100 C B -0.9195
101 N B -0.6250
102 G B 0.0000
103 L B 0.0000
104 Y B -0.1801
105 Y B -0.3020
106 Q B -1.1883
107 G B -0.8419
108 S B -0.4433
109 C B 0.0000
110 Y B 0.0000
111 I B 0.1156
112 L B -0.2861
113 H B -0.8077
114 S B -1.0953
115 D B -1.5676
116 Y B -0.0248
117 Q B -0.3855
118 M B 0.0926
119 F B -0.2766
120 S B -0.4438
121 D B -0.9082
122 A B 0.0000
123 A B -0.6447
124 A B -0.8752
125 N B -1.3434
126 C B 0.0000
127 T B -1.0056
128 A B -1.1167
129 E B -2.1844
130 S B -1.3788
131 S B -1.1323
132 T B -0.7786
133 L B 0.0000
134 P B 0.0000
135 N B -2.1052
136 K B -1.9440
137 S B -1.2835
138 D B -1.8080
139 V B 0.0000
140 M B -0.4015
141 I B 1.4660
142 T B 0.5933
143 W B 0.3276
144 L B 0.0000
145 I B 0.0000
146 D B -1.6375
147 Y B -0.8699
148 V B 0.0000
149 E B -2.7040
150 D B -2.5913
151 T B 0.0000
152 W B 0.0000
153 G B 0.0000
154 S B -1.3996
155 D B -2.1856
156 G B -1.0610
157 N B -1.5700
158 P B -1.4140
159 I B 0.0000
160 T B -2.2172
161 K B -2.2058
162 T B -1.5008
163 T B -1.0430
164 S B -1.3511
165 D B -1.9760
169 S B -1.2649
170 D B -2.2362
171 V B -1.0747
172 S B -1.1732
173 Q B -1.7778
174 E B -1.2494
175 V B -0.1043
176 R B -0.6086
177 K B -0.8773
178 Y B 0.0000
179 F B 0.0000
180 C B 0.0000
181 V B -0.4763
182 K B -1.0059
183 T B -0.4890
184 M B -0.4289
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018