Project name: 5f24efb113c6747

Chain sequence(s)	A: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSQAMSWVRQAPGKGIEWLSTISAEGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDWKFLWAPTGGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:46)

• Minimal score value: -2.6432
• Maximal score value: 1.0235
• Average score: -0.7628
• Total score value: -90.0161

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.6951
2	V	A	-0.6112
3	Q	A	-0.6736
4	L	A	0.0000
5	L	A	0.8978
6	E	A	-0.0611
7	S	A	-0.7385
8	G	A	-1.2386
9	G	A	-0.8394
10	G	A	-0.0529
11	L	A	1.0235
12	V	A	-0.0434
13	Q	A	-1.3605
14	P	A	-1.7011
15	G	A	-1.5280
16	G	A	-1.1283
17	S	A	-1.5652
18	L	A	-1.1416
19	R	A	-2.3744
20	L	A	0.0000
21	S	A	-0.4858
22	C	A	0.0000
23	A	A	-0.1692
24	A	A	0.0000
25	S	A	-0.5244
26	G	A	-0.8552
27	F	A	-0.4064
28	T	A	-0.2731
29	F	A	0.0000
30	S	A	-1.3869
31	S	A	-0.8746
32	Q	A	-1.1025
33	A	A	-0.8370
34	M	A	0.0000
35	S	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-1.0304
40	A	A	-1.4028
41	P	A	-1.0975
42	G	A	-1.5306
43	K	A	-2.3296
44	G	A	-1.2754
45	I	A	-0.3246
46	E	A	-0.6578
47	W	A	0.1584
48	L	A	0.0000
49	S	A	0.0000
50	T	A	-0.0725
51	I	A	0.0000
52	S	A	-1.0752
53	A	A	-1.5263
54	E	A	-2.4115
55	G	A	-1.6592
56	G	A	-1.2688
57	S	A	-0.8849
58	T	A	-0.3564
59	S	A	-0.5919
60	Y	A	-0.9599
61	A	A	-1.3646
62	D	A	-2.4975
63	S	A	-1.7169
64	V	A	0.0000
65	K	A	-2.6432
66	G	A	-1.8579
67	R	A	-1.8188
68	F	A	0.0000
69	T	A	-1.1176
70	I	A	0.0000
71	S	A	-0.5575
72	R	A	-1.2832
73	D	A	-1.8645
74	N	A	-2.1106
75	S	A	-1.6671
76	K	A	-2.4431
77	N	A	-1.8355
78	T	A	-1.0866
79	L	A	0.0000
80	Y	A	-0.6702
81	L	A	0.0000
82	Q	A	-1.7766
83	M	A	0.0000
84	N	A	-2.2036
85	S	A	-1.5387
86	L	A	0.0000
87	R	A	-2.3811
88	A	A	-1.7218
89	E	A	-2.2442
90	D	A	0.0000
91	T	A	-0.8433
92	A	A	0.0000
93	V	A	-0.3321
94	Y	A	0.0000
95	Y	A	-0.1060
96	C	A	0.0000
97	A	A	0.0000
98	K	A	-1.0916
99	D	A	-1.2382
100	W	A	-0.0525
101	K	A	-1.1868
102	F	A	0.0000
103	L	A	0.3028
104	W	A	0.9275
105	A	A	0.2669
106	P	A	-0.3243
107	T	A	-0.5223
108	G	A	-0.5132
109	G	A	-0.4298
110	Q	A	-1.1515
111	G	A	-0.6813
112	T	A	0.0000
113	Q	A	-1.1616
114	V	A	0.0000
115	T	A	-0.2838
116	V	A	0.0000
117	S	A	-0.6556
118	S	A	-0.4950