Project name: query_structure

Status: done

Started: 2026-03-16 23:52:03
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGSKSGIRISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVYRTGGYRHRYLRLGEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:16)
Show buried residues

Minimal score value
-3.6364
Maximal score value
1.9721
Average score
-0.8565
Total score value
-88.2151

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.4573
2 Q A -1.0509
3 V A -1.2315
4 D A -1.3089
5 I A 0.0000
6 V A 1.1822
7 P A 0.4431
8 S A -0.5555
9 Q A -1.7089
10 G A 0.0000
11 E A -2.4607
12 I A 0.0000
13 S A -0.8879
14 V A -0.0952
15 G A -1.2702
16 E A -2.2427
17 S A -1.0699
18 K A -0.4477
19 F A 1.9721
20 F A 0.0000
21 L A 0.9723
22 C A 0.0000
23 Q A -1.2441
24 V A 0.0000
25 A A -0.7398
26 G A -0.8159
27 S A -1.3535
28 K A -2.7666
29 S A -1.9961
30 G A -1.7397
31 I A -1.6630
32 R A -1.5587
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.3318
37 S A -1.3474
38 P A -1.2773
39 N A -2.0722
40 G A -2.1943
41 E A -3.0944
42 K A -2.5170
43 L A 0.0000
44 T A -1.0441
45 P A -0.9450
46 N A -1.9769
47 Q A -2.0509
48 Q A -2.1152
49 R A -1.5112
50 I A 0.0000
51 S A -0.2311
52 V A 0.0000
53 V A 0.6987
54 W A -0.5946
55 N A -1.9100
56 D A -3.2336
57 D A -3.6364
58 S A 0.0000
59 S A -1.7328
60 S A 0.0000
61 T A 0.7334
62 L A 0.0000
63 T A 0.8617
64 I A 0.0000
65 Y A -0.6517
66 N A -1.9638
67 A A 0.0000
68 N A -0.8812
69 I A 0.1460
70 D A -1.3678
71 D A 0.0000
72 A A -0.6004
73 G A -0.3314
74 I A 0.2325
75 Y A 0.0000
76 K A -1.0728
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 Y A -1.1729
81 R A -1.6295
82 T A -1.4734
83 G A -1.2516
84 G A -1.0127
85 Y A -0.3774
86 R A -2.3430
87 H A -2.3542
88 R A -2.5095
89 Y A -0.9347
90 L A -0.2058
91 R A -1.6053
92 L A -0.3541
93 G A -1.1618
94 E A -2.2793
95 A A -1.4169
96 T A -0.6628
97 V A 0.0000
98 N A -1.1682
99 V A 0.0000
100 K A -1.4970
101 I A -0.6437
102 F A 0.2383
103 Q A -0.2062
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018