Project name: 5fbad664a774912

Status: done

Started: 2026-06-23 12:39:29
Settings
Chain sequence(s) A: MSHHHHHHSGKVIDAVIKPLKGDITSAWEVWHLGWNADWTMYEHHKDMRREAKKNPSFNAVVVDEIYYEVQRYMNKMLRKDYEEFKKNKKVVIRGAYNGVIMFWAIRQVMTGKMTPPEAITYFLMHLDPKMSAADRVEAIVFFKDMIVVVVVKMQTPENAKKNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:48)
Show buried residues

Minimal score value
-4.2486
Maximal score value
1.9859
Average score
-1.1424
Total score value
-187.3536

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5599
2 S A -0.6329
3 H A -1.7462
4 H A -2.3375
5 H A -2.6216
6 H A -2.4846
7 H A -2.0693
8 H A -1.4695
9 S A -1.5131
10 G A -1.8501
11 K A -2.3903
12 V A -1.4252
13 I A -1.6499
14 D A -2.8752
15 A A -1.5570
16 V A 0.0000
17 I A 0.0000
18 K A -2.3954
19 P A -1.7049
20 L A -1.5751
21 K A -2.4422
22 G A -2.1151
23 D A -1.8513
24 I A -0.4288
25 T A -0.1692
26 S A -0.4589
27 A A -0.3665
28 W A -0.4009
29 E A -0.9460
30 V A 0.0000
31 W A -0.0778
32 H A -0.2409
33 L A 0.0000
34 G A 0.0000
35 W A -1.1967
36 N A -1.7435
37 A A -0.6472
38 D A -0.2467
39 W A 0.5775
40 T A 0.1117
41 M A 0.0000
42 Y A -0.1941
43 E A -1.4894
44 H A -1.3346
45 H A 0.0000
46 K A -2.8126
47 D A -3.1153
48 M A 0.0000
49 R A -3.1656
50 R A -4.0193
51 E A -3.1148
52 A A 0.0000
53 K A -3.8720
54 K A -3.3435
55 N A -2.3203
56 P A -1.6216
57 S A -1.1133
58 F A -1.1175
59 N A -1.1019
60 A A -0.9125
61 V A 0.6061
62 V A 0.0117
63 V A 0.0000
64 D A -0.4027
65 E A -0.9108
66 I A 0.0000
67 Y A -0.0297
68 Y A 0.0046
69 E A -0.8658
70 V A 0.0000
71 Q A -1.1749
72 R A -2.0344
73 Y A -1.1410
74 M A 0.0000
75 N A 0.0000
76 K A -2.8014
77 M A -1.8935
78 L A 0.0000
79 R A -3.0709
80 K A -3.2660
81 D A 0.0000
82 Y A -2.2549
83 E A -4.0468
84 E A -3.8634
85 F A -3.5270
86 K A -4.0072
87 K A -4.2486
88 N A -4.0346
89 K A -3.8359
90 K A -2.7076
91 V A 0.0000
92 V A 0.2604
93 I A 0.0000
94 R A -2.0236
95 G A 0.0000
96 A A 0.0000
97 Y A -0.1215
98 N A 0.0438
99 G A 0.6875
100 V A 1.9859
101 I A 1.1782
102 M A 0.0000
103 F A 0.6395
104 W A 0.8251
105 A A 0.0000
106 I A 0.0000
107 R A -1.5240
108 Q A -1.5483
109 V A 0.0000
110 M A -1.1228
111 T A -1.2450
112 G A -1.4802
113 K A -2.3009
114 M A -1.4828
115 T A -1.0461
116 P A -1.0042
117 P A -1.0763
118 E A -1.7013
119 A A 0.0000
120 I A -0.3857
121 T A -0.1387
122 Y A 0.3688
123 F A 0.0000
124 L A 0.4314
125 M A 0.8114
126 H A -0.4307
127 L A 0.0000
128 D A -1.6782
129 P A -1.5053
130 K A -2.0831
131 M A -1.2328
132 S A -0.7465
133 A A -0.5089
134 A A -0.6167
135 D A -1.4120
136 R A -1.9728
137 V A -1.2172
138 E A -1.5184
139 A A -0.5891
140 I A 0.2056
141 V A 0.9944
142 F A 0.7682
143 F A 0.1897
144 K A -1.4463
145 D A -0.9302
146 M A -0.1195
147 I A 0.0000
148 V A 0.0000
149 V A 0.0000
150 V A 0.0000
151 V A 0.0000
152 V A 0.0000
153 K A -1.4644
154 M A -0.7415
155 Q A -1.7397
156 T A -1.7243
157 P A -2.2588
158 E A -3.7274
159 N A -3.8129
160 A A -3.1778
161 K A -4.0883
162 K A -4.0341
163 N A -3.1836
164 S A -2.0582
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018