Project name: VHL_WT

Chain sequence(s)	A: MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:39)

• Minimal score value: -4.3053
• Maximal score value: 1.8894
• Average score: -1.0385
• Total score value: -166.158

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.1301
2	E	A	-1.7344
3	A	A	-1.2690
4	G	A	-2.1116
5	R	A	-2.9728
6	P	A	-2.0836
7	R	A	-2.7366
8	P	A	-1.8228
9	V	A	-0.4937
10	L	A	0.0000
11	R	A	-1.2129
12	S	A	0.0000
13	V	A	0.7221
14	N	A	-1.0800
15	S	A	-1.3811
16	R	A	-2.3426
17	E	A	-1.7956
18	P	A	-1.2988
19	S	A	0.0000
20	Q	A	-1.1409
21	V	A	0.0000
22	I	A	-0.6109
23	F	A	0.0000
24	C	A	0.0000
25	N	A	0.0000
26	R	A	-2.2098
27	S	A	0.0000
28	P	A	-1.0015
29	R	A	-0.9857
30	V	A	-0.2035
31	V	A	0.0000
32	L	A	0.0281
33	P	A	0.0000
34	V	A	0.0000
35	W	A	-0.4306
36	L	A	0.0000
37	N	A	-1.1992
38	F	A	-0.8006
39	D	A	-2.4619
40	G	A	-2.0322
41	E	A	-2.8383
42	P	A	-1.7250
43	Q	A	-1.1977
44	P	A	-0.5496
45	Y	A	0.1151
46	P	A	-0.1206
47	T	A	0.0529
48	L	A	0.0000
49	P	A	-0.6454
50	P	A	-1.1086
51	G	A	-1.3170
52	T	A	-0.9453
53	G	A	-1.4118
54	R	A	-1.5763
55	R	A	-2.2281
56	I	A	0.0000
57	H	A	-1.5257
58	S	A	0.0000
59	Y	A	-0.7325
60	R	A	-0.8532
61	G	A	0.1148
62	H	A	0.0000
63	L	A	0.0000
64	W	A	0.0000
65	L	A	0.0000
66	F	A	0.0000
67	R	A	0.0000
68	D	A	0.0000
69	A	A	-0.3755
70	G	A	-0.6320
71	T	A	-0.9145
72	H	A	-1.0085
73	D	A	-0.9146
74	G	A	-0.6831
75	L	A	0.0000
76	L	A	-0.9249
77	V	A	0.0000
78	N	A	-1.4920
79	Q	A	-1.8443
80	T	A	-1.6278
81	E	A	-2.0318
82	L	A	-0.4050
83	F	A	0.0000
84	V	A	1.7890
85	P	A	0.0000
86	S	A	0.4228
87	L	A	0.2281
88	N	A	-0.3348
89	V	A	0.4686
90	D	A	-1.5175
91	G	A	-1.3737
92	Q	A	-1.3481
93	P	A	-0.5768
94	I	A	0.4723
95	F	A	0.4821
96	A	A	0.0000
97	N	A	-0.9983
98	I	A	0.0000
99	T	A	-0.7142
100	L	A	0.3651
101	P	A	0.7586
102	V	A	1.8894
103	Y	A	0.5463
104	T	A	0.1192
105	L	A	0.4319
106	K	A	-1.2547
107	E	A	-1.3387
108	R	A	-0.8493
109	C	A	-0.1195
110	L	A	0.0000
111	Q	A	-0.0152
112	V	A	1.4365
113	V	A	0.9946
114	R	A	0.0168
115	S	A	0.7315
116	L	A	1.5609
117	V	A	-0.0760
118	K	A	-2.1396
119	P	A	-2.3901
120	E	A	-3.4415
121	N	A	-3.1444
122	Y	A	0.0000
123	R	A	-3.8199
124	R	A	-3.3929
125	L	A	-1.8533
126	D	A	-1.9342
127	I	A	-0.1863
128	V	A	0.7009
129	R	A	-1.7093
130	S	A	-0.9362
131	L	A	-1.2483
132	Y	A	0.0000
133	E	A	-3.4630
134	D	A	-2.8527
135	L	A	0.0000
136	E	A	-3.2646
137	D	A	-3.3087
138	H	A	-2.6004
139	P	A	-1.9631
140	N	A	-2.3141
141	V	A	-2.0983
142	Q	A	-3.2658
143	K	A	-3.7751
144	D	A	-3.2583
145	L	A	0.0000
146	E	A	-4.2068
147	R	A	-4.3053
148	L	A	-2.9679
149	T	A	-2.6295
150	Q	A	-3.3306
151	E	A	-3.6894
152	R	A	-3.0282
153	I	A	-1.6201
154	A	A	-2.1405
155	H	A	-2.8995
156	Q	A	-3.1928
157	R	A	-2.8714
158	M	A	-1.2355
159	G	A	-2.0364
160	D	A	-2.6635