Project name: Mb5-11_LLFGLW

Status: done

Started: 2026-07-06 06:28:42
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTGTVYAVTWYPRYGYGESGPLSWNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)
Show buried residues

Minimal score value
-2.6845
Maximal score value
1.5004
Average score
-0.6616
Total score value
-72.1097

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4645
2 Q A -0.6945
3 A A -0.7946
4 N A -0.9823
5 S A -0.9714
6 G A 0.0000
7 S A -1.1256
8 L A -0.9255
9 E A -1.7592
10 V A -0.7352
11 V A 0.3272
12 E A -1.2968
13 A A -1.0971
14 S A -1.3677
15 P A -1.6091
16 T A -1.0574
17 S A -1.2795
18 L A 0.0000
19 Q A -0.8419
20 L A 0.0000
21 S A -0.9637
22 W A 0.0000
23 D A -2.0321
24 A A -1.2496
25 F A 0.0000
26 H A -0.8463
27 R A 0.0000
28 Y A 1.0405
29 H A 0.3051
30 N A -0.5596
31 G A 0.1241
32 F A 1.5004
33 T A 0.7490
34 H A 0.0375
35 P A -0.4286
36 V A -1.0237
37 R A -1.4185
38 Y A -0.8577
39 Y A 0.0000
40 R A -0.7894
41 L A 0.0000
42 T A -0.6332
43 Y A -0.3791
44 G A 0.0000
45 E A -1.2212
46 T A -1.0150
47 G A -1.1368
48 G A -1.2607
49 N A -1.5017
50 S A -0.8786
51 P A -0.3782
52 V A 0.3435
53 Q A -1.1890
54 E A -1.7938
55 F A -0.6547
56 T A -0.1464
57 V A -0.3504
58 P A -0.8961
59 G A -1.1576
60 S A -1.1104
61 K A -1.4332
62 S A -1.0781
63 T A -0.7153
64 A A 0.0000
65 T A -0.3607
66 F A 0.0000
67 S A -0.7495
68 G A -0.9503
69 L A 0.0000
70 K A -2.1275
71 P A -1.7644
72 G A -1.0077
73 V A -0.8805
74 D A -1.7960
75 Y A 0.0000
76 T A -0.7732
77 G A 0.0000
78 T A -0.4937
79 V A 0.0000
80 Y A -0.3837
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.4790
85 Y A 0.0000
86 P A -0.4509
87 R A -1.1022
88 Y A 0.7183
89 G A 0.6775
90 Y A 1.0354
91 G A 0.4148
92 E A -1.1003
93 S A 0.0000
94 G A -0.9553
95 P A -0.6402
96 L A -0.3038
97 S A -0.6703
98 W A 0.0000
99 N A -1.7435
100 Y A -1.3873
101 R A -2.2273
102 T A 0.0000
103 E A -1.6790
104 L A -0.8733
105 D A -2.5060
106 K A -2.6845
107 P A -1.7819
108 S A -1.6389
109 Q A -1.6581
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018