Project name: Mb5-11_I18L_I104L_LLLLVL_Lib2_Top3

Status: done

Started: 2026-07-06 07:00:08
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTLTVYAVTWYPRYGYGESGPVSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:08)
Show buried residues

Minimal score value
-2.8016
Maximal score value
1.4933
Average score
-0.7395
Total score value
-80.6102

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2442
2 Q A -0.9685
3 A A 0.0000
4 N A -1.8783
5 S A -1.4785
6 G A 0.0000
7 S A -1.3030
8 L A -1.0015
9 E A -1.8977
10 V A -0.7339
11 V A 0.0110
12 E A -1.5085
13 A A -1.3691
14 S A -1.6612
15 P A -2.0011
16 T A -1.2664
17 S A -1.2602
18 L A 0.0000
19 Q A -1.1261
20 L A 0.0000
21 S A -1.1425
22 W A 0.0000
23 D A -2.3718
24 A A -1.4802
25 F A 0.0000
26 H A -1.0586
27 R A 0.0000
28 Y A 0.8672
29 H A 0.2126
30 N A -0.5867
31 G A 0.1295
32 F A 1.4933
33 T A 0.7638
34 H A 0.1640
35 P A -0.2740
36 V A -0.8474
37 R A -1.2355
38 Y A -0.8549
39 Y A 0.0000
40 R A -0.8216
41 L A 0.0000
42 T A -0.5707
43 Y A -0.3356
44 G A 0.0000
45 E A -1.5017
46 T A -1.1793
47 G A -1.1993
48 G A -1.3491
49 N A -1.5335
50 S A -0.8877
51 P A -0.3547
52 V A 0.4076
53 Q A -0.9852
54 E A -1.6905
55 F A -0.6625
56 T A -0.2759
57 V A 0.0000
58 P A -1.0067
59 G A -1.2118
60 S A -1.2074
61 K A -1.6950
62 S A -1.2057
63 T A -0.9028
64 A A 0.0000
65 T A -0.4559
66 L A 0.0000
67 S A -0.8047
68 G A -0.9915
69 L A 0.0000
70 K A -2.4676
71 P A -2.0830
72 G A -1.4202
73 V A -1.2213
74 D A -2.1043
75 Y A 0.0000
76 T A -0.7662
77 L A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.3084
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6598
85 Y A 0.0000
86 P A -0.4617
87 R A -1.1306
88 Y A 0.6462
89 G A 0.5671
90 Y A 0.8450
91 G A 0.3519
92 E A -0.5812
93 S A 0.0000
94 G A -0.8944
95 P A -0.5308
96 V A -0.3016
97 S A -0.5641
98 L A -0.6684
99 N A -1.7251
100 Y A -1.5823
101 R A -2.5654
102 T A 0.0000
103 E A -2.5288
104 L A -1.3061
105 D A -2.7298
106 K A -2.8016
107 P A -1.7907
108 S A -1.6410
109 Q A -1.6644
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018