Project name: Mb5-11_VFLLLL

Chain sequence(s)	A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRFTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTLTVYAVTWYPRYGYGESGPLSLNYRTELDKPSQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)

• Minimal score value: -2.7173
• Maximal score value: 1.2366
• Average score: -0.74
• Total score value: -80.6554

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.2697
2	Q	A	-0.9263
3	A	A	-0.7890
4	N	A	-1.5682
5	S	A	-1.1773
6	G	A	-1.3449
7	S	A	-1.1968
8	L	A	-0.9694
9	E	A	-1.7969
10	V	A	-0.5751
11	V	A	0.1201
12	E	A	-1.3904
13	A	A	-1.1503
14	S	A	-1.4253
15	P	A	-1.7406
16	T	A	-1.1634
17	S	A	-1.1248
18	L	A	0.0000
19	Q	A	-0.8517
20	V	A	0.0000
21	S	A	-0.9719
22	W	A	0.0000
23	D	A	-1.9594
24	A	A	-1.2771
25	F	A	0.0000
26	H	A	-1.3196
27	R	A	-0.7051
28	Y	A	0.3650
29	H	A	-0.1830
30	N	A	-0.7513
31	G	A	-0.0637
32	F	A	1.2366
33	T	A	0.3929
34	H	A	-0.0731
35	P	A	-0.5387
36	V	A	-1.0430
37	R	A	-1.4517
38	Y	A	-0.9240
39	Y	A	0.0000
40	R	A	-0.8962
41	F	A	0.0000
42	T	A	-0.6016
43	Y	A	0.0000
44	G	A	-0.6007
45	E	A	-1.3692
46	T	A	-1.1398
47	G	A	-1.1660
48	G	A	-1.3103
49	N	A	-1.5117
50	S	A	-0.8426
51	P	A	-0.3069
52	V	A	0.4670
53	Q	A	-0.8635
54	E	A	-1.6913
55	F	A	-0.7435
56	T	A	-0.3218
57	V	A	0.0000
58	P	A	-1.0093
59	G	A	-1.2294
60	S	A	-1.1650
61	K	A	-1.4957
62	S	A	-1.0876
63	T	A	-0.7162
64	A	A	0.0000
65	T	A	-0.4037
66	L	A	0.0000
67	S	A	-0.7660
68	G	A	-1.0005
69	L	A	0.0000
70	K	A	-2.4006
71	P	A	-1.9631
72	G	A	-1.1945
73	V	A	-1.1295
74	D	A	-2.0278
75	Y	A	0.0000
76	T	A	-0.7909
77	L	A	0.0000
78	T	A	-0.5344
79	V	A	0.0000
80	Y	A	-0.3606
81	A	A	0.0000
82	V	A	0.0000
83	T	A	0.0000
84	W	A	0.5813
85	Y	A	0.0000
86	P	A	-0.4359
87	R	A	-1.0951
88	Y	A	0.7279
89	G	A	0.7304
90	Y	A	1.1303
91	G	A	0.2767
92	E	A	-0.7701
93	S	A	0.0000
94	G	A	-0.6355
95	P	A	-0.6439
96	L	A	0.0000
97	S	A	-0.6302
98	L	A	-0.7220
99	N	A	-1.7138
100	Y	A	-1.4695
101	R	A	-2.4028
102	T	A	0.0000
103	E	A	-1.9221
104	L	A	-1.0203
105	D	A	-2.5833
106	K	A	-2.7173
107	P	A	-1.7910
108	S	A	-1.6441
109	Q	A	-1.6645