Project name: Mb5-11_I18L_I104L_LVVGYR_Lib2_Top15

Status: done

Started: 2026-07-06 06:59:14
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATVSGLKPGVDYTGTVYAVTWYPRYGYGESGPYSRNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-2.7096
Maximal score value
1.4825
Average score
-0.7237
Total score value
-78.8876

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3368
2 Q A -0.8805
3 A A -1.1154
4 N A -1.8433
5 S A -1.3764
6 G A -1.3754
7 S A -1.1241
8 L A 0.0000
9 E A -1.0682
10 V A -0.3988
11 V A 0.6839
12 E A -1.2514
13 A A -1.0728
14 S A -1.4790
15 P A -1.7307
16 T A -1.1477
17 S A -1.3457
18 L A 0.0000
19 Q A -0.6994
20 L A 0.0000
21 S A -0.6565
22 W A 0.0000
23 D A -2.0224
24 A A -1.3843
25 F A 0.0000
26 H A -1.0143
27 R A 0.0000
28 Y A 0.8844
29 H A 0.1895
30 N A -0.5835
31 G A 0.2263
32 F A 1.4825
33 T A 0.7713
34 H A 0.0609
35 P A -0.3848
36 V A -0.9961
37 R A -1.4477
38 Y A -0.9089
39 Y A 0.0000
40 R A -0.8742
41 V A 0.0000
42 T A 0.0000
43 Y A -0.5246
44 G A -0.6957
45 E A -1.4818
46 T A -1.2205
47 G A -1.1824
48 G A -1.3400
49 N A -1.5384
50 S A -0.9294
51 P A -0.4196
52 V A 0.2978
53 Q A -1.2086
54 E A -1.8111
55 F A -0.6732
56 T A -0.1892
57 V A -0.4223
58 P A -0.9500
59 G A -1.2297
60 S A -1.2105
61 K A -1.6303
62 S A -1.1438
63 T A -0.6720
64 A A 0.0000
65 T A -0.3203
66 V A 0.0000
67 S A -0.7817
68 G A -0.9839
69 L A 0.0000
70 K A -2.3977
71 P A -1.9585
72 G A -1.2441
73 V A -1.1761
74 D A -2.1446
75 Y A 0.0000
76 T A -1.2528
77 G A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.3450
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.4436
85 Y A 0.0000
86 P A -0.4491
87 R A -1.1057
88 Y A 0.7090
89 G A 0.6860
90 Y A 1.0607
91 G A 0.2421
92 E A -0.8108
93 S A 0.0000
94 G A -0.6901
95 P A -0.6550
96 Y A -0.4995
97 S A -1.1107
98 R A -1.8271
99 N A -2.4307
100 Y A 0.0000
101 R A -2.6150
102 T A 0.0000
103 E A -2.1420
104 L A -0.9878
105 D A -2.5786
106 K A -2.7096
107 P A -1.7881
108 S A -1.6437
109 Q A -1.6596
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018