Project name: 6198e5616e763d3

Status: done

Started: 2026-02-28 14:19:25
Settings
Chain sequence(s) B: DEKAKTAETLIWQLFGKAMQQSDPNEAEKLLKKAEELAKKANDPRLEQVVRQHQVVVRFLVG
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:11)
Show buried residues

Minimal score value
-4.2103
Maximal score value
2.4692
Average score
-1.5171
Total score value
-94.0571

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D B -3.6518
2 E B -4.2103
3 K B -3.8293
4 A B -3.5863
5 K B -3.5409
6 T B -2.2132
7 A B -1.8021
8 E B -1.6601
9 T B -0.7366
10 L B 0.0269
11 I B 0.0000
12 W B 0.1360
13 Q B -0.9506
14 L B 0.0000
15 F B -0.2374
16 G B -1.0069
17 K B -1.8989
18 A B 0.0000
19 M B -0.7291
20 Q B -1.7714
21 Q B -1.9825
22 S B -1.5732
23 D B -2.4310
24 P B -2.4317
25 N B -2.9603
26 E B -3.1386
27 A B 0.0000
28 E B -3.1895
29 K B -3.5389
30 L B -2.7921
31 L B 0.0000
32 K B -3.6643
33 K B -3.3444
34 A B 0.0000
35 E B -3.2238
36 E B -3.6624
37 L B -2.5091
38 A B 0.0000
39 K B -3.5445
40 K B -3.1989
41 A B -2.8661
42 N B -2.6722
43 D B -2.3526
44 P B -2.1808
45 R B -2.8221
46 L B 0.0000
47 E B -2.7567
48 Q B -2.5500
49 V B -1.4424
50 V B 0.0000
51 R B -1.6815
52 Q B -1.2957
53 H B 0.0000
54 Q B -0.5608
55 V B 0.8549
56 V B 1.3071
57 V B 0.0000
58 R B 0.2645
59 F B 2.4132
60 L B 2.4692
61 V B 0.6920
62 G B -0.0299
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018