Project name: H-Ferritin-Mms6

Status: done

Started: 2026-06-08 06:32:13
Settings
Chain sequence(s) A: PSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:13)
Show buried residues

Minimal score value
-3.7424
Maximal score value
1.8395
Average score
-1.1709
Total score value
-201.4028

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 P A -0.6263
6 S A -1.0177
7 Q A -0.9507
8 V A -0.2841
9 R A -1.4421
10 Q A -1.9602
11 N A -2.4590
12 Y A 0.0000
13 H A -2.2500
14 Q A -2.2871
15 D A -2.1368
16 A A 0.0000
17 E A -1.4634
18 A A -1.2442
19 A A -1.4867
20 I A 0.0000
21 N A -0.5674
22 R A -1.6031
23 Q A 0.0000
24 I A 0.0000
25 N A -0.8154
26 L A -0.3562
27 E A 0.0000
28 L A 0.0000
29 Y A -0.2880
30 A A 0.0000
31 S A 0.0000
32 Y A 0.3148
33 V A 0.0000
34 Y A 0.0000
35 L A 0.9610
36 S A -0.3269
37 M A 0.0000
38 S A 0.0000
39 C A -0.3460
40 Y A 0.0000
41 F A 0.0000
42 D A -3.1925
43 R A -3.1060
44 D A -3.3921
45 D A -3.0147
46 V A -2.1820
47 A A -2.1133
48 L A -1.8577
49 K A -2.6441
50 N A -1.9183
51 F A 0.0000
52 A A 0.0000
53 K A -1.9687
54 Y A -0.9632
55 F A 0.0000
56 L A -0.4642
57 H A -1.8741
58 Q A -1.7615
59 S A 0.0000
60 H A -2.7053
61 E A -3.6220
62 E A 0.0000
63 R A -3.0956
64 E A -3.7424
65 H A -2.2894
66 A A 0.0000
67 E A -2.9243
68 K A -2.1458
69 L A 0.0000
70 M A -1.8171
71 K A -2.6898
72 L A 0.0000
73 Q A 0.0000
74 N A -2.3823
75 Q A -2.1538
76 R A 0.0000
77 G A 0.0000
78 G A 0.0000
79 R A -1.3698
80 I A 0.1948
81 F A 1.8395
82 L A 1.0202
83 Q A -1.3254
84 D A -2.5423
85 I A -1.5612
86 K A -3.0402
87 K A -3.2424
88 P A -2.4220
89 D A -3.3196
90 R A -3.3060
91 D A -3.3942
92 D A -2.8500
93 W A 0.0000
94 E A -2.5397
95 S A -1.4476
96 G A 0.0000
97 L A 0.0000
98 N A -1.0126
99 A A 0.0000
100 M A 0.0000
101 E A -0.9066
102 C A -0.6559
103 A A 0.0000
104 L A -1.1824
105 H A -1.4721
106 L A 0.0000
107 E A 0.0000
108 K A -1.6948
109 S A -1.3528
110 V A 0.0000
111 N A -1.1560
112 Q A -1.7403
113 S A -1.6155
114 L A 0.0000
115 L A -1.2044
116 E A -2.3663
117 L A 0.0000
118 H A -2.1429
119 K A -2.8272
120 L A -2.2606
121 A A 0.0000
122 T A -2.4458
123 D A -2.9301
124 K A -2.9825
125 N A -2.7267
126 D A 0.0000
127 P A -1.6685
128 H A -1.8950
129 L A 0.0000
130 C A -1.9711
131 D A -2.5322
132 F A 0.0000
133 I A 0.0000
134 E A -2.2024
135 T A -1.1963
136 Y A -0.4490
137 Y A 0.0000
138 L A -0.6782
139 S A -0.8342
140 E A -1.7318
141 Q A 0.0000
142 V A -0.2054
143 K A -2.1334
144 S A -1.7623
145 I A -1.5624
146 K A -2.6017
147 E A -2.3148
148 L A 0.0000
149 G A -1.8902
150 D A -2.1926
151 H A -1.7059
152 V A 0.0000
153 T A -1.7527
154 N A -1.8070
155 L A 0.0000
156 R A -3.0755
157 K A -2.5780
158 M A -1.2554
159 G A -1.6122
160 A A 0.0000
161 P A -1.6985
162 E A -2.1251
163 A A -0.9590
164 G A -0.2921
165 M A 0.9597
166 A A 0.0000
167 E A -0.1584
168 Y A 0.6180
169 L A 0.3456
170 F A 0.0000
171 D A -0.9059
172 K A -1.7978
173 H A -1.5411
174 T A -0.9282
175 L A -1.1034
176 G A -1.5713
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018