Project name: query_structure

Status: done

Started: 2026-03-16 22:58:33
Settings
Chain sequence(s) A: CGEGLFTCRSTNICISHAWVCDGVDDCEDNSDENNCSAPASEPPGSLCGADQFRCGNGSCVPRAWRCDGVDDCGDGSDEAPEICETPTCQSNEFRCRSGRCIPQHWLCDGLNDCGDGSDESQQCSAPASEPPGSL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:51)
Show buried residues

Minimal score value
-3.7906
Maximal score value
1.3165
Average score
-1.2288
Total score value
-165.8851

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A 0.4046
2 G A -0.8188
3 E A -1.9931
4 G A -1.1843
5 L A 0.1800
6 F A 0.0439
7 T A -0.2031
8 C A 0.0000
9 R A -2.8710
10 S A -2.1903
11 T A -1.7237
12 N A -1.3517
13 I A -0.0711
14 C A 0.6589
15 I A 0.0000
16 S A 0.1802
17 H A -0.6409
18 A A 0.0798
19 W A 0.5557
20 V A -0.1733
21 C A -0.6356
22 D A -0.2573
23 G A -0.5186
24 V A -0.0555
25 D A -2.2301
26 D A -1.5250
27 C A 0.0000
28 E A -3.2801
29 D A -3.7906
30 N A -3.5121
31 S A 0.0000
32 D A 0.0000
33 E A -1.8935
34 N A -2.7076
35 N A -1.8966
36 C A -0.7998
37 S A -0.6271
38 A A -0.6534
39 P A -0.6652
40 A A -0.7582
41 S A -1.2332
42 E A -2.2274
43 P A -1.3957
44 P A -0.9267
45 G A -1.0416
46 S A -1.0105
47 L A 0.0066
48 C A -0.7507
49 G A -1.1481
50 A A -1.2778
51 D A -2.5649
52 Q A -2.1885
53 F A -1.5681
54 R A -1.6800
55 C A 0.0000
56 G A -1.8792
57 N A -2.4175
58 G A -1.6098
59 S A -1.2506
60 C A -0.8711
61 V A 0.0000
62 P A -1.6119
63 R A -2.5867
64 A A -1.3050
65 W A -1.0985
66 R A -1.4953
67 C A -1.3194
68 D A -1.8569
69 G A -0.9474
70 V A -0.1288
71 D A -2.1873
72 D A -1.7099
73 C A 0.0000
74 G A -2.2273
75 D A -3.1256
76 G A -2.1308
77 S A 0.0000
78 D A 0.0000
79 E A -1.8013
80 A A 0.0000
81 P A -1.7603
82 E A -2.4008
83 I A -1.1737
84 C A -1.8600
85 E A -2.8332
86 T A -1.4479
87 P A -1.3003
88 T A -1.0283
89 C A -1.6796
90 Q A -2.1253
91 S A -1.6808
92 N A -2.5134
93 E A -2.3584
94 F A -1.8511
95 R A -2.6617
96 C A 0.0000
97 R A -3.0537
98 S A -2.6288
99 G A -2.5192
100 R A -2.9436
101 C A -1.9914
102 I A 0.0000
103 P A -1.5086
104 Q A -2.2615
105 H A -1.6141
106 W A -0.5244
107 L A -0.6953
108 C A -0.7612
109 D A -1.5320
110 G A -0.6710
111 L A 0.1683
112 N A -1.5107
113 D A -1.2897
114 C A 0.0000
115 G A -2.1905
116 D A -2.8574
117 G A -1.9082
118 S A 0.0000
119 D A 0.0000
120 E A -1.3616
121 S A -1.6486
122 Q A -1.8209
123 Q A -1.7100
124 C A -1.0831
125 S A -0.9354
126 A A -0.3968
127 P A -0.6051
128 A A -0.5149
129 S A -1.2943
130 E A -2.2492
131 P A -1.5333
132 P A -1.0719
133 G A -0.7408
134 S A 0.2235
135 L A 1.3165
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018