Project name: 61f985059219932

Chain sequence(s)	A: IGPLAIPVAAILGFLATDAWSHADELVAGVKQGWERS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)

• Minimal score value: -2.9979
• Maximal score value: 3.2435
• Average score: 0.4018
• Total score value: 14.8669

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	I	A	2.1514
2	G	A	1.2192
3	P	A	1.0790
4	L	A	1.7613
5	A	A	1.4549
6	I	A	1.7114
7	P	A	1.6352
8	V	A	2.6241
9	A	A	2.0580
10	A	A	2.1330
11	I	A	3.1651
12	L	A	3.2435
13	G	A	2.1884
14	F	A	3.0634
15	L	A	2.6959
16	A	A	1.4464
17	T	A	0.6461
18	D	A	-0.5568
19	A	A	-0.3922
20	W	A	-0.0703
21	S	A	-1.3552
22	H	A	-1.6346
23	A	A	-0.8493
24	D	A	-1.7403
25	E	A	-1.7243
26	L	A	0.5228
27	V	A	0.8986
28	A	A	-0.3039
29	G	A	-0.2657
30	V	A	0.8489
31	K	A	-1.2541
32	Q	A	-1.8281
33	G	A	-1.3543
34	W	A	-1.0029
35	E	A	-2.8525
36	R	A	-2.9979
37	S	A	-1.4973